Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P42224: Variant p.Lys673Arg

Signal transducer and activator of transcription 1-alpha/beta
Gene: STAT1
Feedback?
Variant information Variant position: help 673 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Lysine (K) to Arginine (R) at position 673 (K673R, p.Lys673Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are large size and basic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In IMD31A; impairs tyrosine phosphorylation; results in impaired STAT1-mediated cellular response to IFN-gamma and interleukin-27. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 673 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 750 The length of the canonical sequence.
Location on the sequence: help VMAAENIPENPLKYLYPNID K DHAFGKYYSRPKEAPEPMEL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         VMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMEL

Mouse                         VMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMEL

Pig                           VMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMEL

Caenorhabditis elegans        QL-------KDIRYMYPAIDKEEMLRFFESEERHRVG----
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 2 – 750 Signal transducer and activator of transcription 1-alpha/beta
Modified residue 657 – 657 ADP-ribosyl glutamic acid; by PARP14
Modified residue 665 – 665 N6-methyllysine
Mutagenesis 657 – 657 E -> Q. Loss of ADP-ribosylation and increased Tyr-701 phosphorylation; when associated with Q-705.
Mutagenesis 665 – 665 K -> A. No effect on IFN-alpha-induced STAT1 phosphorylation and nuclear translocation.
Helix 673 – 677



Literature citations
Dominant-negative STAT1 SH2 domain mutations in unrelated patients with Mendelian susceptibility to mycobacterial disease.
Tsumura M.; Okada S.; Sakai H.; Yasunaga S.; Ohtsubo M.; Murata T.; Obata H.; Yasumi T.; Kong X.F.; Abhyankar A.; Heike T.; Nakahata T.; Nishikomori R.; Al-Muhsen S.; Boisson-Dupuis S.; Casanova J.L.; Alzahrani M.; Shehri M.A.; Elghazali G.; Takihara Y.; Kobayashi M.;
Hum. Mutat. 33:1377-1387(2012)
Cited for: VARIANTS IMD31A GLU-637 AND ARG-673; CHARACTERIZATION OF VARIANTS IMD31A GLU-637 AND ARG-673;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.