Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q8IY92: Variant p.Ser1123Tyr

Structure-specific endonuclease subunit SLX4
Gene: SLX4
Feedback?
Variant information Variant position: help 1123
Type of variant: help LB/B
Residue change: help From Serine (S) to Tyrosine (Y) at position 1123 (S1123Y, p.Ser1123Tyr).
Physico-chemical properties: help Change from small size and polar (S) to large size and aromatic (Y)
BLOSUM score: help -2
Other resources: help


Sequence information Variant position: help 1123
Protein sequence length: help 1834
Location on the sequence: help RRSVLECRNKGVLMFPEKSP S IDLTQSNPDHSSSRSQKSSS
Residue conservation: help 
Human                         RRSVLECRNKGVLMFPEKSPSIDLTQSNPDHSSSRSQKSSS

Mouse                         SSPIAGHRNRGILISPAKSPPIDLTQSVPEPLSPRAQDPLH

Drosophila                    -----------------SDASVDLTQNSDD-----------

Baker's yeast                 ---------------------ISIVSDTTD-----------

Fission yeast                 -----------------------------------------
Sequence annotation in neighborhood: help
TypePositionsDescription
Chain 1 – 1834 Structure-specific endonuclease subunit SLX4
Region 684 – 1834 Interaction with PLK1 and TERF2-TERF2IP
Region 902 – 1151 Disordered
Modified residue 1121 – 1121 Phosphoserine
Modified residue 1135 – 1135 Phosphoserine
Cross 1112 – 1112 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)
Cross 1120 – 1120 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)



Literature citations
Analysis of the novel Fanconi anemia gene SLX4/FANCP in familial breast cancer cases.
Bakker J.L.; van Mil S.E.; Crossan G.; Sabbaghian N.; De Leeneer K.; Poppe B.; Adank M.; Gille H.; Verheul H.; Meijers-Heijboer H.; de Winter J.P.; Claes K.; Tischkowitz M.; Waisfisz Q.;
Hum. Mutat. 34:70-73(2013)
Cited for: VARIANTS PHE-38; TRP-141; ALA-197; CYS-204; GLN-237; ARG-284; THR-378; THR-385; VAL-386; VAL-424; LYS-457; GLU-458; THR-505; ASN-506; MET-568; PRO-579; SER-671; LYS-787; VAL-870; GLY-894; LEU-929; GLN-942; MET-952; LEU-975; LYS-1007; TRP-1060; LEU-1122; TYR-1123; VAL-1221; PHE-1271; VAL-1286; GLY-1287; GLY-1342; PHE-1421; SER-1476; TRP-1550; VAL-1694; CYS-1814 AND SER-1834; CHARACTERIZATION OF VARIANTS THR-378; LYS-787; TRP-1550 AND CYS-1814; NO ASSOCIATION WITH BREAST CANCER;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.