Home  |  Contact

UniProtKB/Swiss-Prot P49773: Variant p.His112Asn

Histidine triad nucleotide-binding protein 1
Gene: HINT1
Variant information

Variant position:  112
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Histidine (H) to Asparagine (N) at position 112 (H112N, p.His112Asn).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Similar physico-chemical property. Both residues are medium size and polar.
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Neuromyotonia and axonal neuropathy, autosomal recessive (NMAN) [MIM:137200]: An autosomal recessive neurologic disorder characterized by onset in the first or second decade of a peripheral axonal neuropathy predominantly affecting motor more than sensory nerves. The axonal neuropathy is reminiscent of Charcot-Marie-Tooth disease type 2 and distal hereditary motor neuropathy. Individuals with NMAN also have delayed muscle relaxation and action myotonia associated with neuromyotonic discharges on needle EMG resulting from hyperexcitability of the peripheral nerves. {ECO:0000269|PubMed:16835243, ECO:0000269|PubMed:22961002}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In NMAN; the enzyme has no residual activity although the mutant protein is expressed at normal levels.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  112
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  126
The length of the canonical sequence.

Location on the sequence:   KGYRMVVNEGSDGGQSVYHV  H LHVLGGRQMHWPPG
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         KGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG

Mouse                         RGYRMVVNEGADGGQSVYHIHLHVLGGRQMNWPPG

Rat                           RGYRMVVNEGADGGQSVYHIHLHVLGGRQMNWPPG

Bovine                        KGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG

Rabbit                        KGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 2 – 126 Histidine triad nucleotide-binding protein 1
Domain 18 – 126 HIT
Nucleotide binding 112 – 114 Purine nucleotide phosphoramidate
Motif 110 – 114 Histidine triad motif
Active site 112 – 112 Tele-AMP-histidine intermediate
Binding site 99 – 99 Purine nucleotide phosphoramidate
Mutagenesis 97 – 97 V -> DE. Loss of dimerization. Strongly reduced enzyme activity.
Mutagenesis 105 – 105 G -> A. Reduces enzyme activity.
Mutagenesis 107 – 107 S -> A. Reduces enzyme activity.
Mutagenesis 114 – 114 H -> A. Nearly abolishes enzyme activity.
Mutagenesis 123 – 123 W -> A. Nearly abolishes enzyme activity.


Literature citations

The histidine triad protein Hint1 triggers apoptosis independent of its enzymatic activity.
Weiske J.; Huber O.;
J. Biol. Chem. 281:27356-27366(2006)
Cited for: FUNCTION; CATALYTIC ACTIVITY; MUTAGENESIS OF GLY-105 AND SER-107; CHARACTERIZATION OF VARIANT NMAN ASN-112; SUBUNIT; IDENTIFICATION IN A COMPLEX WITH KAT5;

Loss-of-function mutations in HINT1 cause axonal neuropathy with neuromyotonia.
Zimon M.; Baets J.; Almeida-Souza L.; De Vriendt E.; Nikodinovic J.; Parman Y.; Battaloglu E.; Matur Z.; Guergueltcheva V.; Tournev I.; Auer-Grumbach M.; De Rijk P.; Petersen B.S.; Muller T.; Fransen E.; Van Damme P.; Loscher W.N.; Barisic N.; Mitrovic Z.; Previtali S.C.; Topaloglu H.; Bernert G.; Beleza-Meireles A.; Todorovic S.; Savic-Pavicevic D.; Ishpekova B.; Lechner S.; Peeters K.; Ooms T.; Hahn A.F.; Zuchner S.; Timmerman V.; Van Dijck P.; Rasic V.M.; Janecke A.R.; De Jonghe P.; Jordanova A.;
Nat. Genet. 44:1080-1083(2012)
Cited for: VARIANTS NMAN PRO-37; ARG-51; ARG-84; VAL-89; ASP-93 AND ASN-112; CHARACTERIZATION OF VARIANTS NMAN PRO-37; ARG-51; ARG-84 AND ASN-112;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.