UniProtKB/Swiss-Prot O60563: Variant p.Arg541Cys

Cyclin-T1
Gene: CCNT1
Feedback?

Variant information Variant position:

541 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Arginine (R) to Cysteine (C) at position 541 (R541C, p.Arg541Cys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from large size and basic (R) to medium size and polar (C) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs201951577 [ dbSNP | Ensembl ]

Sequence information Variant position:

541 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

726 The length of the canonical sequence.
Location on the sequence:

HNHHSHKHSHSQLPVGTGNK R PGDPKHSSQTSNLAHKTYSL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         HNHHSHKHSHSQLPVGTGNKRPGDPKHSSQTSNLAHKTYSL

Chimpanzee                    HNHHSHKHSHSQLPVGTGNKRPGDPKHSSQTSNLAHKTYSL

Mouse                         HNHHSHRHSHLQLPAGPVSKRPSDPKHSSQTSTLAHKTYSL

Bovine                        HNHHSHKHSHSQLPAGTGNKRLGDPKHSSQTSTLAHKPYSL

Horse                         HNHHSHKHSHSQLPAGTGNKRPGDPKHSSQTSTLAHKTYSL

Caenorhabditis elegans        --------------------RMAGKLDSSTSSEKRARIDPL

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 726	Cyclin-T1
Region	480 – 550	Histidine-rich domain (HRD)
Region	487 – 650	Disordered
Region	527 – 570	Required for interaction with ZMYND8
Modified residue	530 – 530	ADP-ribosylhistidine
Modified residue	531 – 531	ADP-ribosylserine
Modified residue	549 – 549	ADP-ribosylserine
Modified residue	552 – 552	ADP-ribosylserine
Modified residue	556 – 556	ADP-ribosylhistidine
Alternative sequence	185 – 726	Missing. In isoform 2.

Literature citations
Diagnostic exome sequencing in persons with severe intellectual disability.
de Ligt J.; Willemsen M.H.; van Bon B.W.; Kleefstra T.; Yntema H.G.; Kroes T.; Vulto-van Silfhout A.T.; Koolen D.A.; de Vries P.; Gilissen C.; del Rosario M.; Hoischen A.; Scheffer H.; de Vries B.B.; Brunner H.G.; Veltman J.A.; Vissers L.E.;
N. Engl. J. Med. 367:1921-1929(2012)
Cited for: VARIANT CYS-541;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.