Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q14738: Variant p.Pro53Ser

Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
Gene: PPP2R5D
Feedback?
Variant information Variant position: help 53 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Proline (P) to Serine (S) at position 53 (P53S, p.Pro53Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (P) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help Found in a patient with delayed psychomotor development, no speech and cataracts; no effect on binding to subunit PPP2CA; no effect on binding to subunit PPP2R1A. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 53 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 602 The length of the canonical sequence.
Location on the sequence: help TEEAQPQPQPQPQPQAQSQP P SSNKRPSNSTPPPTQLSKIK The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         TEEAQPQPQPQPQPQAQSQPPSSNKRPSNSTPP-------------------------PTQL--------SKIK

Rabbit                        AEEAQPQPQPQPQPQPQSQPPSSNKRPSNSTPP--------

Baker's yeast                 STKKTSSRKGQEQSKQSQQPSQSQKQGSSSSSAAIMNPTPV

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 602 Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
Region 1 – 96 Disordered
Compositional bias 46 – 55 Low complexity
Modified residue 63 – 63 Phosphothreonine
Alternative sequence 11 – 116 Missing. In isoform Delta-3.



Literature citations
Diagnostic exome sequencing in persons with severe intellectual disability.
de Ligt J.; Willemsen M.H.; van Bon B.W.; Kleefstra T.; Yntema H.G.; Kroes T.; Vulto-van Silfhout A.T.; Koolen D.A.; de Vries P.; Gilissen C.; del Rosario M.; Hoischen A.; Scheffer H.; de Vries B.B.; Brunner H.G.; Veltman J.A.; Vissers L.E.;
N. Engl. J. Med. 367:1921-1929(2012)
Cited for: VARIANT SER-53; B56delta-related protein phosphatase 2A dysfunction identified in patients with intellectual disability.
Houge G.; Haesen D.; Vissers L.E.; Mehta S.; Parker M.J.; Wright M.; Vogt J.; McKee S.; Tolmie J.L.; Cordeiro N.; Kleefstra T.; Willemsen M.H.; Reijnders M.R.; Berland S.; Hayman E.; Lahat E.; Brilstra E.H.; van Gassen K.L.; Zonneveld-Huijssoon E.; de Bie C.I.; Hoischen A.; Eichler E.E.; Holdhus R.; Steen V.M.; Doeskeland S.O.; Hurles M.E.; FitzPatrick D.R.; Janssens V.;
J. Clin. Invest. 125:3051-3062(2015)
Cited for: VARIANTS HJS1 LYS-198; LYS-200; ARG-201 AND ARG-207; VARIANT SER-53; CHARACTERIZATION OF VARIANTS HJS1 LYS-198; LYS-200; ARG-201 AND ARG-207; CHARACTERIZATION OF VARIANT SER-53;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.