Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q8NCM8: Variant p.Gly3909Asp

Cytoplasmic dynein 2 heavy chain 1
Gene: DYNC2H1
Feedback?
Variant information Variant position: help 3909 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help US The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Glycine (G) to Aspartate (D) at position 3909 (G3909D, p.Gly3909Asp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to medium size and acidic (D) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help Found in short rib-polydactyly syndrome 3/6; uncertain significance; digenic inheritance; the patient also carries a mutation in NEK1. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 3909 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 4307 The length of the canonical sequence.
Location on the sequence: help YEFSLSDLRAGYNIIDRLFD G AKDVQWEFVHGLLENAIYGG The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         YEFSLSDLRAGYNIIDRLFDGAKDVQWEFVHGLLENAIYGG

Mouse                         YEFSLSDLRAGYHVIDRLFDGTKDVQWEFVHGLLENSIYGG

Rat                           YEFSLSDLRAGYHVIDRLFDGSKDVQWEFVHGLLENSIYGG

Caenorhabditis elegans        YEFGASDVRVAKSFVEQL--TANKADWEFVRGILKFVIYGG

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 4307 Cytoplasmic dynein 2 heavy chain 1
Alternative sequence 736 – 4122 Missing. In isoform 3.
Beta strand 3909 – 3911



Literature citations
NEK1 mutations cause short-rib polydactyly syndrome type majewski.
Thiel C.; Kessler K.; Giessl A.; Dimmler A.; Shalev S.A.; von der Haar S.; Zenker M.; Zahnleiter D.; Stoess H.; Beinder E.; Abou Jamra R.; Ekici A.B.; Schroeder-Kress N.; Aigner T.; Kirchner T.; Reis A.; Brandstaetter J.H.; Rauch A.;
Am. J. Hum. Genet. 88:106-114(2011)
Cited for: INVOLVEMENT IN DIGENIC SHORT-RIB THORACIC DYSPLASIA 3/6 WITH POLYDACTYLY; VARIANT ASP-3909;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.