Home  |  Contact

UniProtKB/Swiss-Prot Q86TC9: Variant p.Pro1112Leu

Myopalladin
Gene: MYPN
Chromosomal location: 10q21.3
Variant information

Variant position:  1112
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Proline (P) to Leucine (L) at position 1112 (P1112L, p.Pro1112Leu).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Similar physico-chemical property. Both residues are medium size and hydrophobic.
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Cardiomyopathy, dilated 1KK (CMD1KK) [MIM:615248]: A disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death. {ECO:0000269|PubMed:18006477, ECO:0000269|PubMed:22286171, ECO:0000269|PubMed:22892539}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Involvement in disease:  Cardiomyopathy, familial hypertrophic 22 (CMH22) [MIM:615248]: A hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death. {ECO:0000269|PubMed:22286171}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In CMD1KK and CMH22; results in sarcomere disorganization and premature cell death.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  1112
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1320
The length of the canonical sequence.

Location on the sequence:   LDCKVSGLPPPELTWLLNGQ  P VLPDASHKMLVRETGVHSLL
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         LDCKVSGLPPPELTWLLNGQPVLPDASHKMLVRETGVHSLL

Mouse                         LDCKVSGLPPPELTWLLNGQPVLPDASHKMLVRETGVHSLL

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 1320 Myopalladin
Domain 1073 – 1162 Ig-like 4
Region 945 – 1320 Interaction with ACTN
Disulfide bond 1094 – 1146
Alternative sequence 508 – 1320 Missing. In isoform 3.


Literature citations

Molecular basis for clinical heterogeneity in inherited cardiomyopathies due to myopalladin mutations.
Purevjav E.; Arimura T.; Augustin S.; Huby A.C.; Takagi K.; Nunoda S.; Kearney D.L.; Taylor M.D.; Terasaki F.; Bos J.M.; Ommen S.R.; Shibata H.; Takahashi M.; Itoh-Satoh M.; McKenna W.J.; Murphy R.T.; Labeit S.; Yamanaka Y.; Machida N.; Park J.E.; Alexander P.M.; Weintraub R.G.; Kitaura Y.; Ackerman M.J.; Kimura A.; Towbin J.A.;
Hum. Mol. Genet. 21:2039-2053(2012)
Cited for: INVOLVEMENT IN RCM4; VARIANTS CMH22 CYS-20; ARG-153; GLU-217; ALA-410; THR-841; LEU-1112 AND PRO-1265; VARIANTS CMD1KK CYS-20; VAL-213; PHE-339; THR-611; THR-882 AND LEU-954; VARIANTS ALA-393; LYS-467; LYS-614; LEU-628; ASN-691; ASN-707; ARG-803; ARG-804; GLN-955; THR-1135; ILE-1161 AND GLY-1306; CHARACTERIZATION OF VARIANT CMH22 CYS-20;

Mutations in the Z-band protein myopalladin gene and idiopathic dilated cardiomyopathy.
Duboscq-Bidot L.; Xu P.; Charron P.; Neyroud N.; Dilanian G.; Millaire A.; Bors V.; Komajda M.; Villard E.;
Cardiovasc. Res. 77:118-125(2008)
Cited for: VARIANTS CMD1KK HIS-1088; LEU-1112 AND MET-1195; CHARACTERIZATION OF VARIANTS CMD1KK LEU-1112 AND MET-1195;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.