Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P78381: Variant p.Val331Ile

UDP-galactose translocator
Gene: SLC35A2
Feedback?
Variant information Variant position: help 331 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Valine (V) to Isoleucine (I) at position 331 (V331I, p.Val331Ile). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In CDG2M; in patient fibroblasts, results in reduced UDP-galactose transport into the Golgi; able to rescue defective Gb3Cer expression in SLC35A2-deficient cells. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 331 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 396 The length of the canonical sequence.
Location on the sequence: help ASIRLFGFHVDPLFALGAGL V IGAVYLYSLPRGAAKAIASA The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         ASIRLFGFHVDPLFALGAGLVIGAVYLYSLPRGAAKAI----ASA

                              ASIRLFGFHVDPLFALGAGLVIGAVYLYSLPRGTAKAIAST

Mouse                         ASIRLFGFHLDPLFALGAGLVIGAVYLYSLPRGAVKAI---

Bovine                        ASIRLFGFHVDPLFALGAGLVIGAVYLYSLPRGAAKAI---

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 396 UDP-galactose translocator
Transmembrane 315 – 335 Helical
Alternative sequence 143 – 396 VTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGGGPRPLDQNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVATRGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFATSLSIVLSTVASIRLFGFHVDPLFALGAGLVIGAVYLYSLPRGAAKAIASASASASGPCVHQQPPGQPPPPQLSSHRGDLITEPFLPKLLTKVKGS -> PSPRCSQSHSLCLCLRLRALRSPAASRAATTTAAVFPPWRPHHGALSAKVSAGEVRAGSNGGTQGRGTGVEGVGHLQDPSRHPPGPGSSGFGRWSFLPGH. In isoform 3.



Literature citations
Mosaicism of the UDP-galactose transporter SLC35A2 causes a congenital disorder of glycosylation.
Ng B.G.; Buckingham K.J.; Raymond K.; Kircher M.; Turner E.H.; He M.; Smith J.D.; Eroshkin A.; Szybowska M.; Losfeld M.E.; Chong J.X.; Kozenko M.; Li C.; Patterson M.C.; Gilbert R.D.; Nickerson D.A.; Shendure J.; Bamshad M.J.; Freeze H.H.;
Am. J. Hum. Genet. 92:632-636(2013)
Cited for: VARIANT CDG2M ILE-331; CHARACTERIZATION OF VARIANT CDG2M ILE-331; FUNCTION; Functional analyses of the UDP-galactose transporter SLC35A2 using the binding of bacterial Shiga toxins as a novel activity assay.
Li D.; Mukhopadhyay S.;
Glycobiology 29:490-503(2019)
Cited for: CHARACTERIZATION OF VARIANTS LEU-55; MET-258; CYS-267; ARG-282 AND PRO-304; CHARACTERIZATION OF VARIANTS CDG2M PHE-213; VAL-266 AND ILE-331; MUTAGENESIS OF LYS-78; GLY-202; GLY-214 AND LYS-297; FUNCTION; SLC35A2-CDG: Functional characterization, expanded molecular, clinical, and biochemical phenotypes of 30 unreported individuals.
Ng B.G.; Sosicka P.; Agadi S.; Almannai M.; Bacino C.A.; Barone R.; Botto L.D.; Burton J.E.; Carlston C.; Chung B.H.; Cohen J.S.; Coman D.; Dipple K.M.; Dorrani N.; Dobyns W.B.; Elias A.F.; Epstein L.; Gahl W.A.; Garozzo D.; Hammer T.B.; Haven J.; Heron D.; Herzog M.; Hoganson G.E.; Hunter J.M.; Jain M.; Juusola J.; Lakhani S.; Lee H.; Lee J.; Lewis K.; Longo N.; Lourenco C.M.; Mak C.C.Y.; McKnight D.; Mendelsohn B.A.; Mignot C.; Mirzaa G.; Mitchell W.; Muhle H.; Nelson S.F.; Olczak M.; Palmer C.G.S.; Partikian A.; Patterson M.C.; Pierson T.M.; Quinonez S.C.; Regan B.M.; Ross M.E.; Guillen Sacoto M.J.; Scaglia F.; Scheffer I.E.; Segal D.; Singhal N.S.; Striano P.; Sturiale L.; Symonds J.D.; Tang S.; Vilain E.; Willis M.; Wolfe L.A.; Yang H.; Yano S.; Powis Z.; Suchy S.F.; Rosenfeld J.A.; Edmondson A.C.; Grunewald S.; Freeze H.H.;
Hum. Mutat. 40:908-925(2019)
Cited for: VARIANTS CDG2M PRO-55; 56-TYR--SER-396 DEL; 65-PHE--THR-68 DEL; MET-71; PHE-82; PRO-101; PRO-116; ARG-118; CYS-130; 168-GLN--SER-396 DEL; LEU-175 DEL; PHE-175; 183-GLN--SER-396 DEL; SER-188; PRO-233; 272-TRP--SER-396 DEL; ASP-273; PRO-303; TYR-312; PRO-315 AND ILE-331; CHARACTERIZATION OF VARIANTS CDG2M MET-71; PHE-82; CYS-130; 168-GLN--SER-396 DEL; PRO-233 AND PRO-315; FUNCTION;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.