UniProtKB/SwissProt variant VAR

Variant information

Variant position:

873

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:

LP/P [Disclaimer]

The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Threonine (T) to Arginine (R) at position 873 (T873R, p.Thr873Arg).

Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:

Change from medium size and polar (T) to large size and basic (R)

The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:

-1

The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page

Variant description:

In MDS and myeloid malignancies.

Any additional useful information about the variant.

Sequence information

Variant position:

873

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:

1596

The length of the canonical sequence.

Location on the sequence:

LSPVSESHSEETIPSDSGIG T DNNSTSDQAEKSSESRRRYS

The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         LSPVSESHSEETIPSDSGIGTDNNSTSDQAEKSSESRRRYS

Mouse                         LSPVSESHSEETIPSDSGIGTDNNSTSDQAEKSSESRRRYS

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 1596	SET-binding protein
Region	854 – 889	Disordered
Compositional bias	854 – 882	Polar residues
Alternative sequence	243 – 1596	Missing. In isoform 2.

Literature citations

Mutations in SETBP1 are recurrent in myelodysplastic syndromes and often coexist with cytogenetic markers associated with disease progression.
Fernandez-Mercado M.; Pellagatti A.; Di Genua C.; Larrayoz M.J.; Winkelmann N.; Aranaz P.; Burns A.; Schuh A.; Calasanz M.J.; Cross N.C.; Boultwood J.;
Br. J. Haematol. 163:235-239(2013)
Cited for: VARIANT MDS ARG-873; VARIANTS AML ARG-870 AND SER-871;

SETBP1 mutations occur in 9% of MDS/MPN and in 4% of MPN cases and are strongly associated with atypical CML, monosomy 7, isochromosome i(17)(q10), ASXL1 and CBL mutations.
Meggendorfer M.; Bacher U.; Alpermann T.; Haferlach C.; Kern W.; Gambacorti-Passerini C.; Haferlach T.; Schnittger S.;
Leukemia 27:1852-1860(2013)
Cited for: VARIANTS MYELOID MALIGNANCIES LYS-858; ASN-868; TYR-868; GLY-868; ARG-869; SER-870; ASP-870; VAL-870; THR-871; ARG-873; ASN-874 AND ASN-908;

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9Y6X0: Variant p.Thr873Arg