Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9Y6X0: Variant p.Thr873Arg

SET-binding protein
Gene: SETBP1
Feedback?
Variant information Variant position: help 873 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Threonine (T) to Arginine (R) at position 873 (T873R, p.Thr873Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (T) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In MDS and myeloid malignancies. Any additional useful information about the variant.


Sequence information Variant position: help 873 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1596 The length of the canonical sequence.
Location on the sequence: help LSPVSESHSEETIPSDSGIG T DNNSTSDQAEKSSESRRRYS The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         LSPVSESHSEETIPSDSGIGTDNNSTSDQAEKSSESRRRYS

Mouse                         LSPVSESHSEETIPSDSGIGTDNNSTSDQAEKSSESRRRYS
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 1596 SET-binding protein
Region 854 – 889 Disordered
Compositional bias 854 – 880 Polar residues
Alternative sequence 243 – 1596 Missing. In isoform 2.



Literature citations
Mutations in SETBP1 are recurrent in myelodysplastic syndromes and often coexist with cytogenetic markers associated with disease progression.
Fernandez-Mercado M.; Pellagatti A.; Di Genua C.; Larrayoz M.J.; Winkelmann N.; Aranaz P.; Burns A.; Schuh A.; Calasanz M.J.; Cross N.C.; Boultwood J.;
Br. J. Haematol. 163:235-239(2013)
Cited for: VARIANT MDS ARG-873; VARIANTS AML ARG-870 AND SER-871; SETBP1 mutations occur in 9% of MDS/MPN and in 4% of MPN cases and are strongly associated with atypical CML, monosomy 7, isochromosome i(17)(q10), ASXL1 and CBL mutations.
Meggendorfer M.; Bacher U.; Alpermann T.; Haferlach C.; Kern W.; Gambacorti-Passerini C.; Haferlach T.; Schnittger S.;
Leukemia 27:1852-1860(2013)
Cited for: VARIANTS MYELOID MALIGNANCIES LYS-858; ASN-868; TYR-868; GLY-868; ARG-869; SER-870; ASP-870; VAL-870; THR-871; ARG-873; ASN-874 AND ASN-908;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.