Home  |  Contact

UniProtKB/Swiss-Prot P53674: Variant p.Val96Phe

Beta-crystallin B1
Gene: CRYBB1
Chromosomal location: 22q12.1
Variant information

Variant position:  96
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Valine (V) to Phenylalanine (F) at position 96 (V96F, p.Val96Phe).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and hydrophobic (V) to large size and aromatic (F)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Cataract 17, multiple types (CTRCT17) [MIM:611544]: An opacification of the crystalline lens of the eye that frequently results in visual impairment or blindness. Opacities vary in morphology, are often confined to a portion of the lens, and may be static or progressive. In general, the more posteriorly located and dense an opacity, the greater the impact on visual function. CTRCT17 includes nuclear and pulverulent cataracts, among others. Nuclear cataracts affect the central nucleus of the eye, are often not highly visually significant. The density of the opacities varies greatly from fine dots to a dense, white and chalk-like, central cataract. The condition is usually bilateral. Nuclear cataracts are often combined with opacified cortical fibers encircling the nuclear opacity, which are referred to as cortical riders. Pulverulent cataracts are characterized by a dust-like, 'pulverised' appearance of the opacities which can be found in any part of the lens. {ECO:0000269|PubMed:12360425, ECO:0000269|PubMed:17460281, ECO:0000269|PubMed:23508780}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In CTRCT17.
Any additional useful information about the variant.



Sequence information

Variant position:  96
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  252
The length of the canonical sequence.

Location on the sequence:   FSGECSNLADRGFDRVRSII  V SAGPWVAFEQSNFRGEMFIL
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         FSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFIL

Mouse                         FSGECLNLGDRGFDRVRSLIVVSGPWVAFEQSAFRGEMFVL

Rat                           FSGECLNLGDRGFDRVRSLIVLSGPWVAFEQSAFRGEMFVL

Pig                           FSGECLNLGDRGFDRVRSIIVTSGPWVAFEQSNFRGEMFIL

Bovine                        FSGECLNLGDRGFERVRSIIVTSGPWVAFEQSNFRGEMFVL

Chicken                       FTSECLNLADCGFDRVRSVIVSSGPWVAYEQANMRGEMFIL

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 2 – 252 Beta-crystallin B1
Domain 59 – 98 Beta/gamma crystallin 'Greek key' 1
Beta strand 93 – 98


Literature citations

Whole exome sequencing in dominant cataract identifies a new causative factor, CRYBA2, and a variety of novel alleles in known genes.
Reis L.M.; Tyler R.C.; Muheisen S.; Raggio V.; Salviati L.; Han D.P.; Costakos D.; Yonath H.; Hall S.; Power P.; Semina E.V.;
Hum. Genet. 132:761-770(2013)
Cited for: VARIANT CTRCT17 PHE-96;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.