Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O14649: Variant p.Val221Leu

Potassium channel subfamily K member 3
Gene: KCNK3
Feedback?
Variant information Variant position: help 221 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Valine (V) to Leucine (L) at position 221 (V221L, p.Val221Leu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In PPH4; likely pathogenic; loss of function. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 221 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 394 The length of the canonical sequence.
Location on the sequence: help GFGDYVALQKDQALQTQPQY V AFSFVYILTGLTVIGAFLNL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         GFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLNL

Mouse                         GFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLNL

Rat                           GFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLNL

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 394 Potassium channel subfamily K member 3
Binding site 201 – 201
Binding site 201 – 201
Binding site 202 – 202
Mutagenesis 230 – 230 T -> A. No effect on channel basal activity.
Mutagenesis 231 – 231 G -> A. No effect on channel basal activity.
Mutagenesis 232 – 232 L -> A. No effect on channel basal activity.
Mutagenesis 233 – 233 T -> A. No effect on channel basal activity.
Mutagenesis 234 – 234 V -> A. No effect on channel basal activity.
Mutagenesis 235 – 235 I -> A. No effect on channel basal activity.
Mutagenesis 236 – 236 G -> A. No effect on channel basal activity.
Mutagenesis 237 – 237 A -> V. Markedly increases potassium current amplitude. Channel hyperactivity is associated with marked decrease of protein surface expression.
Mutagenesis 238 – 238 F -> A. No effect on channel basal activity.
Mutagenesis 239 – 239 L -> A. No effect on channel basal activity.
Mutagenesis 240 – 240 N -> A. No effect on channel basal activity.
Mutagenesis 241 – 241 L -> A. Markedly increases potassium current amplitude. Channel hyperactivity is associated with marked decrease of protein surface expression.
Helix 218 – 241



Literature citations
A novel channelopathy in pulmonary arterial hypertension.
Ma L.; Roman-Campos D.; Austin E.D.; Eyries M.; Sampson K.S.; Soubrier F.; Germain M.; Tregouet D.A.; Borczuk A.; Rosenzweig E.B.; Girerd B.; Montani D.; Humbert M.; Loyd J.E.; Kass R.S.; Chung W.K.;
N. Engl. J. Med. 369:351-361(2013)
Cited for: INVOLVEMENT IN PPH4; VARIANTS PPH4 LYS-8; ARG-97; LYS-182; CYS-192; ASP-203 AND LEU-221; CHARACTERIZATION OF VARIANTS PPH4 LYS-8; ARG-97; LYS-182; CYS-192; ASP-203 AND LEU-221;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.