UniProtKB/Swiss-Prot O75800: Variant p.Arg369Trp

Zinc finger MYND domain-containing protein 10
Gene: ZMYND10
Feedback?

Variant information Variant position:

369 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Arginine (R) to Tryptophan (W) at position 369 (R369W, p.Arg369Trp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from large size and basic (R) to large size and aromatic (W) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs142613783 [ dbSNP | Ensembl ]

Sequence information Variant position:

369 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

440 The length of the canonical sequence.
Location on the sequence:

WQAIAKHQLQHVFSPSEQDL R LQARRWAETYRLDVLEAVAP The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         WQAIAKHQLQHVFSPSEQDLRLQARRWAETYRLDVLEAVAP

Mouse                         WQAIAKHQLQHVFSLSEKDLRQQAQRWAETYRLDVLEAVAP

Rat                           WQAIAKHQLQHVFSLSEKDLRQQAQRWAETYRLDVLEAVAP

Xenopus laevis                WKAIAKYQVKQAFSPSEEDLRSQAKRWAQTYNMDVMEALVP

Zebrafish                     WKAIAKYQVTNVFNPSESELREQASRLAQTYNLDVMENLIP

Drosophila                    FYQIAQDQDSVFLSKNKENICALATRLSKAYGTDLLCELEQ

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 440	Zinc finger MYND domain-containing protein 10
Region	366 – 440	Interaction with DNAAF11

Literature citations
A novel gene (BLu) that resides in the lung cancer region on chromosome 3p21.3 has the MYND Zn finger-like module.
Duh F.-M.; Latif F.; Bader S.; Sekido Y.; Kuzmin I.; Minna J.D.; Koonin E.; Lerman M.I.;
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2); VARIANT TRP-369;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.