Home  |  Contact

UniProtKB/Swiss-Prot Q96RY7: Variant p.Cys1360Arg

Intraflagellar transport protein 140 homolog
Gene: IFT140
Variant information

Variant position:  1360
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Cysteine (C) to Arginine (R) at position 1360 (C1360R, p.Cys1360Arg).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (C) to large size and basic (R)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Short-rib thoracic dysplasia 9 with or without polydactyly (SRTD9) [MIM:266920]: A form of short-rib thoracic dysplasia, a group of autosomal recessive ciliopathies that are characterized by a constricted thoracic cage, short ribs, shortened tubular bones, and a 'trident' appearance of the acetabular roof. Polydactyly is variably present. Non-skeletal involvement can include cleft lip/palate as well as anomalies of major organs such as the brain, eye, heart, kidneys, liver, pancreas, intestines, and genitalia. Some forms of the disease are lethal in the neonatal period due to respiratory insufficiency secondary to a severely restricted thoracic cage, whereas others are compatible with life. Disease spectrum encompasses Ellis-van Creveld syndrome, asphyxiating thoracic dystrophy (Jeune syndrome), Mainzer-Saldino syndrome, and short rib-polydactyly syndrome. SRTD9 is characterized by phalangeal cone-shaped epiphyses, chronic renal disease, nearly constant retinal dystrophy, and mild radiographic abnormality of the proximal femur. Occasional features include short stature, cerebellar ataxia, and hepatic fibrosis. {ECO:0000269|PubMed:22503633, ECO:0000269|PubMed:23418020, ECO:0000269|PubMed:24009529, ECO:0000269|PubMed:28288023, ECO:0000269|PubMed:28724397}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In SRTD9; disease phenotype consistent with Mainzer-Saldino syndrome.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  1360
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1462
The length of the canonical sequence.

Location on the sequence:   KRFIQARRTYTEDPKESIKQ  C ELLLEEPDLDSTIRIGDVYG
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         KRFIQARRTYTEDPKESIKQCELLLEEPDLDSTIRIGDVYG

Mouse                         KRFIQARRTYTEDPKESLRQCELLLEEPDLDSTIRVGDVYG

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 1462 Intraflagellar transport protein 140 homolog


Literature citations

Combined NGS approaches identify mutations in the intraflagellar transport gene IFT140 in skeletal ciliopathies with early progressive kidney Disease.
Schmidts M.; Frank V.; Eisenberger T.; Al Turki S.; Bizet A.A.; Antony D.; Rix S.; Decker C.; Bachmann N.; Bald M.; Vinke T.; Toenshoff B.; Di Donato N.; Neuhann T.; Hartley J.L.; Maher E.R.; Bogdanovic R.; Peco-Antic A.; Mache C.; Hurles M.E.; Joksic I.; Guc-Scekic M.; Dobricic J.; Brankovic-Magic M.; Bolz H.J.; Pazour G.J.; Beales P.L.; Scambler P.J.; Saunier S.; Mitchison H.M.; Bergmann C.;
Hum. Mutat. 34:714-724(2013)
Cited for: SUBCELLULAR LOCATION; VARIANTS HIS-110; THR-161; GLY-243; SER-459; HIS-514; GLY-787 AND ARG-1353; VARIANTS SRTD9 PHE-152; GLY-267; MET-292; GLU-522 AND ARG-1360; CHARACTERIZATION OF VARIANT SRTD9 MET-292;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.