Home  |  Contact

UniProtKB/Swiss-Prot P36871: Variant p.Gly291Arg

Phosphoglucomutase-1
Gene: PGM1
Variant information

Variant position:  291
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LP/P [Disclaimer]
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Glycine (G) to Arginine (R) at position 291 (G291R, p.Gly291Arg).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from glycine (G) to large size and basic (R)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In CDG1T; reduces strongly phosphoglucomutase activity.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  291
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  562
The length of the canonical sequence.

Location on the sequence:   DLVETMKSGEHDFGAAFDGD  G DRNMILGKHGFFVNPSDSVA
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         DLVETMKSGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVA

Mouse                         DLVETMKSGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVA

Rat                           DLVETMKSGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVA

Bovine                        DLVETMKTGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVA

Rabbit                        DLVETMKSGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVA

Slime mold                    LLVKKMNNGEFDMGCASDGDGDRNMILGKR-FFLNPSDSVA

Baker's yeast                 TLVDRVDREKIAFGAASDGDGDRNMIYGYGPAFVSPGDSVA

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 562 Phosphoglucomutase-1
Metal binding 288 – 288 Magnesium
Metal binding 290 – 290 Magnesium
Metal binding 292 – 292 Magnesium
Beta strand 291 – 298


Literature citations

Induced structural disorder as a molecular mechanism for enzyme dysfunction in phosphoglucomutase 1 deficiency.
Stiers K.M.; Kain B.N.; Graham A.C.; Beamer L.J.;
J. Mol. Biol. 428:1493-1505(2016)
Cited for: X-RAY CRYSTALLOGRAPHY (1.85 ANGSTROMS) OF WILD-TYPE; VARIANT CDG1T ARG-121 AND VARIANT ARG-291 IN COMPLEX WITH MAGNESIUM; COFACTOR;

A novel congenital disorder of glycosylation type without central nervous system involvement caused by mutations in the phosphoglucomutase 1 gene.
Perez B.; Medrano C.; Ecay M.J.; Ruiz-Sala P.; Martinez-Pardo M.; Ugarte M.; Perez-Cerda C.;
J. Inherit. Metab. Dis. 36:535-542(2013)
Cited for: VARIANT CDG1T ARG-291;

Multiple phenotypes in phosphoglucomutase 1 deficiency.
Tegtmeyer L.C.; Rust S.; van Scherpenzeel M.; Ng B.G.; Losfeld M.E.; Timal S.; Raymond K.; He P.; Ichikawa M.; Veltman J.; Huijben K.; Shin Y.S.; Sharma V.; Adamowicz M.; Lammens M.; Reunert J.; Witten A.; Schrapers E.; Matthijs G.; Jaeken J.; Rymen D.; Stojkovic T.; Laforet P.; Petit F.; Aumaitre O.; Czarnowska E.; Piraud M.; Podskarbi T.; Stanley C.A.; Matalon R.; Burda P.; Seyyedi S.; Debus V.; Socha P.; Sykut-Cegielska J.; van Spronsen F.; de Meirleir L.; Vajro P.; DeClue T.; Ficicioglu C.; Wada Y.; Wevers R.A.; Vanderschaeghe D.; Callewaert N.; Fingerhut R.; van Schaftingen E.; Freeze H.H.; Morava E.; Lefeber D.J.; Marquardt T.;
N. Engl. J. Med. 370:533-542(2014)
Cited for: VARIANTS CDG1T ALA-19; TYR-38; ARG-41; HIS-62; ALA-115; ARG-121; TYR-263; GLY-263; ARG-291; ARG-330; LYS-377; LYS-388 AND PRO-516;

Compromised catalysis and potential folding defects in in vitro studies of missense mutants associated with hereditary phosphoglucomutase 1 deficiency.
Lee Y.; Stiers K.M.; Kain B.N.; Beamer L.J.;
J. Biol. Chem. 289:32010-32019(2014)
Cited for: CHARACTERIZATION OF VARIANTS CDG1T ALA-19; TYR-38; ARG-41; HIS-62; ALA-115; ARG-121; GLY-263; TYR-263; ARG-291; ARG-330; LYS-377; LYS-388 AND PRO-516; VARIANTS MET-68; CYS-221 AND HIS-420; CATALYTIC ACTIVITY; BIOPHYSICOCHEMICAL PROPERTIES; ACTIVE SITE; PHOSPHORYLATION AT SER-117; ACTIVITY REGULATION;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.