Home  |  Contact

UniProtKB/Swiss-Prot P06276: Variant p.Arg498Trp

Cholinesterase
Gene: BCHE
Variant information

Variant position:  498
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LB/B
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Arginine (R) to Tryptophan (W) at position 498 (R498W, p.Arg498Trp).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (R) to large size and aromatic (W)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  Does not affect enzymatic activity.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  498
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  602
The length of the canonical sequence.

Location on the sequence:   LERRDNYTKAEEILSRSIVK  R WANFAKYGNPNETQNNSTSW
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         LERRDNYTKAEEILSRSIVKRWANFAKYGNPNETQNNSTSW

Mouse                         LGRRVNYTRAEEIFSRSIMKTWANFAKYGHPNGTQGNSTMW

Bovine                        LERRVNYTKAEEIFSRSIMKRWANFAKYGNPNGTQNNSTRW

Rabbit                        LERRVNYTKAEEILSRSIMKRWANFAKYGNPNGTQNNSTRW

Cat                           LERRVNYTRAEEILSRSIMNYWANFAKYGNPNGTQNNSTRW

Horse                         LERRVNYTRAEEILSRSIMKRWANFAKYGNPNGTQNNSTRW

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 29 – 602 Cholinesterase
Glycosylation 483 – 483 N-linked (GlcNAc...) (complex) asparagine
Glycosylation 509 – 509 N-linked (GlcNAc...) asparagine
Glycosylation 513 – 513 N-linked (GlcNAc...) asparagine
Glycosylation 514 – 514 N-linked (GlcNAc...) asparagine
Disulfide bond 428 – 547
Helix 486 – 505


Literature citations

Five new naturally occurring mutations of the BCHE gene and frequencies of 12 butyrylcholinesterase alleles in a Brazilian population.
Mikami L.R.; Wieseler S.; Souza R.L.; Schopfer L.M.; Nachon F.; Lockridge O.; Chautard-Freire-Maia E.A.;
Pharmacogenet. Genomics 18:213-218(2008)
Cited for: VARIANT BCHED CYS-361; VARIANTS ARG-40; MET-322 AND TRP-498; CHARACTERIZATION OF VARIANT BCHED CYS-361; CHARACTERIZATION OF VARIANTS ARG-40; MET-322 AND TRP-498;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.