UniProtKB/SwissProt variant VAR

Variant information

Variant position:

183

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:

Disease [Disclaimer]

The variants are classified into three categories: Disease, Polymorphism and Unclassified.

Disease: Variants implicated in disease according to literature reports.
Polymorphism: Variants not reported to be implicated in disease.
Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:

From Threonine (T) to Alanine (A) at position 183 (T183A, p.Thr183Ala).

Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:

Change from medium size and polar (T) to small size and hydrophobic (A)

The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:

0

The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page

Involvement in disease:

Bardet-Biedl syndrome 5 (BBS5) [MIM:615983]: A syndrome characterized by usually severe pigmentary retinopathy, early-onset obesity, polydactyly, hypogenitalism, renal malformation and mental retardation. Secondary features include diabetes mellitus, hypertension and congenital heart disease. Bardet-Biedl syndrome inheritance is autosomal recessive, but three mutated alleles (two at one locus, and a third at a second locus) may be required for clinical manifestation of some forms of the disease. {ECO:0000269|PubMed:15137946, ECO:0000269|PubMed:18203199, ECO:0000269|PubMed:21344540}. Note=The disease is caused by mutations affecting the gene represented in this entry.

The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:

In BBS5; found in patient of Sri Lankan origin; not detected in patients of Northern European origin.

Any additional useful information about the variant.

Other resources:

Links to websites of interest for the variant.

Variant rs121908582 [ dbSNP | Ensembl ]

Sequence information

Variant position:

183

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:

341

The length of the canonical sequence.

Location on the sequence:

KINGVWNLSSDQGNLGTFFI T NVRIVWHANMNDSFNVSIPY

The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         KINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPY

Mouse                         KINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPY

Xenopus laevis                KINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPY

Zebrafish                     KINGVWNLSSDQGNLGTFFITNVRIVWHANMNESFNVSIPY

Caenorhabditis elegans        KVNGVWNLSTETGSLGVFVITNIRVVWYAEMNIGYNVSVPY

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 341	Bardet-Biedl syndrome 5 protein

Literature citations

Novel mutations in BBS5 highlight the importance of this gene in non-Caucasian Bardet-Biedl syndrome patients.
Hjortshoj T.D.; Gronskov K.; Philp A.R.; Nishimura D.Y.; Adeyemo A.; Rotimi C.N.; Sheffield V.C.; Rosenberg T.; Brondum-Nielsen K.;
Am. J. Med. Genet. A 146A:517-520(2008)
Cited for: VARIANTS BBS5 SER-72 AND ALA-183;

UniProtKB/Swiss-Prot Q8N3I7: Variant p.Thr183Ala