Home  |  Contact

UniProtKB/Swiss-Prot Q9NPP4: Variant p.His443Pro

NLR family CARD domain-containing protein 4
Gene: NLRC4
Variant information

Variant position:  443
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LP/P [Disclaimer]
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Histidine (H) to Proline (P) at position 443 (H443P, p.His443Pro).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (H) to medium size and hydrophobic (P)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In FCAS4; the mutation increases oligomerization of the NLRC4 protein; results in hyperactivation of caspase-1 with an increase in IL1B protein secretion.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  443
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1024
The length of the canonical sequence.

Location on the sequence:   TTGLLCKYTAQRFKPKYKFF  H KSFQEYTAGRRLSSLLTSHE
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         TTGLLCKYTAQRFKPKYKFFHKSFQEYTAGRRLSSLLTSHE

Mouse                         TIGLLCKYTAQRLKPTYKFFHKSFQEYTAGRRLSSLLTSKE

Rat                           RTGLLCKYTAQRLRPTYKFFHKSFQEYTAGRRLSSLLKSRE

Bovine                        TTGLLCKYTAQRFKPKYKFFHQSFQEYTAGRRLSSLLTSGE

Xenopus tropicalis            NIGLLNKYTAQRRKAVYRYFHTTFQEYIAGRRLSQLLSSED

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 1024 NLR family CARD domain-containing protein 4
Domain 163 – 476 NACHT
Region 356 – 463 Winged-helix domain (WHD)
Alternative sequence 89 – 753 Missing. In isoform 2.
Alternative sequence 93 – 1024 Missing. In isoform 4.
Alternative sequence 157 – 1024 Missing. In isoform 3.


Literature citations

An inherited mutation in NLRC4 causes autoinflammation in human and mice.
Kitamura A.; Sasaki Y.; Abe T.; Kano H.; Yasutomo K.;
J. Exp. Med. 211:2385-2396(2014)
Cited for: INVOLVEMENT IN FCAS4; VARIANT FCAS4 PRO-443; CHARACTERIZATION OF VARIANT FCAS4 PRO-443; SUBUNIT;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.