Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q96RR1: Variant p.Asn585Ser

Twinkle mtDNA helicase
Gene: TWNK
Feedback?
Variant information Variant position: help 585 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Asparagine (N) to Serine (S) at position 585 (N585S, p.Asn585Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (N) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In PRLTS5. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 585 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 684 The length of the canonical sequence.
Location on the sequence: help DKELQTASIFGSAKASQEAD N VLILQDRKLVTGPGKRYLQV The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         DKELQTASIFGSAKASQEADNVLILQDRKLVTGPGKRYLQV

Mouse                         DKELQTASIFGSAKASQEADNVLILQDRKLVTGPGKRYLQV

Chicken                       EKELQTASIFGSAKASQEADNVLILQDRKLTTGPGKRYLQV

Drosophila                    EDELTTSSVFGTAKATQEADNVLIIQDKRLTSVRGKKYLQI
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 32 – 684 Twinkle mtDNA helicase
Domain 384 – 635 SF4 helicase
Region 405 – 590 Maybe required for stable oligomeric structure
Alternative sequence 532 – 684 Missing. In isoform 3.
Alternative sequence 583 – 684 Missing. In isoform 2.



Literature citations
Mutations in Twinkle primase-helicase cause Perrault syndrome with neurologic features.
Morino H.; Pierce S.B.; Matsuda Y.; Walsh T.; Ohsawa R.; Newby M.; Hiraki-Kamon K.; Kuramochi M.; Lee M.K.; Klevit R.E.; Martin A.; Maruyama H.; King M.C.; Kawakami H.;
Neurology 83:2054-2061(2014)
Cited for: INVOLVEMENT IN PRLTS5; VARIANTS PRLTS5 HIS-391; GLY-441; ILE-507 AND SER-585;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.