Home  |  Contact

UniProtKB/Swiss-Prot P16410: Variant p.Arg70Trp

Cytotoxic T-lymphocyte protein 4
Gene: CTLA4
Variant information

Variant position:  70
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LP/P [Disclaimer]
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Arginine (R) to Tryptophan (W) at position 70 (R70W, p.Arg70Trp).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (R) to large size and aromatic (W)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In ALPS5.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  70
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  223
The length of the canonical sequence.

Location on the sequence:   SRGIASFVCEYASPGKATEV  R VTVLRQADSQVTEVCAATYM
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         SRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYM

                              SRGVASFVCEYGSSGNAAEVRVTMLRQAGSQMTEVCAATYT

Mouse                         SHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFT

Pig                           SRGVASFVCEYGSAGKAAEVRVTVLRRAGSQMTEVCAATYT

Rabbit                        SRGVASFVCEYASSHKATEVRVTVLRQANSQMTEVCAMTYT

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 36 – 223 Cytotoxic T-lymphocyte protein 4
Topological domain 36 – 161 Extracellular
Domain 39 – 140 Ig-like V-type
Disulfide bond 58 – 129
Alternative sequence 38 – 204 Missing. In isoform 2 and isoform 3.
Alternative sequence 58 – 58 C -> S. In isoform 4.
Alternative sequence 59 – 204 Missing. In isoform 4.
Mutagenesis 70 – 70 R -> AD. Strongly reduced interaction with CD80, CD86 and ICOSLG.
Beta strand 68 – 77


Literature citations

Autosomal dominant immune dysregulation syndrome in humans with CTLA4 mutations.
Schubert D.; Bode C.; Kenefeck R.; Hou T.Z.; Wing J.B.; Kennedy A.; Bulashevska A.; Petersen B.S.; Schaeffer A.A.; Gruening B.A.; Unger S.; Frede N.; Baumann U.; Witte T.; Schmidt R.E.; Dueckers G.; Niehues T.; Seneviratne S.; Kanariou M.; Speckmann C.; Ehl S.; Rensing-Ehl A.; Warnatz K.; Rakhmanov M.; Thimme R.; Hasselblatt P.; Emmerich F.; Cathomen T.; Backofen R.; Fisch P.; Seidl M.; May A.; Schmitt-Graeff A.; Ikemizu S.; Salzer U.; Franke A.; Sakaguchi S.; Walker L.S.; Sansom D.M.; Grimbacher B.;
Nat. Med. 20:1410-1416(2014)
Cited for: POLYMORPHISM; INVOLVEMENT IN ALPS5; VARIANT ALPS5 TRP-70;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.