Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O96017: Variant p.Tyr390Cys

Serine/threonine-protein kinase Chk2
Gene: CHEK2
Feedback?
Variant information Variant position: help 390 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Tyrosine (Y) to Cysteine (C) at position 390 (Y390C, p.Tyr390Cys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and aromatic (Y) to medium size and polar (C) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In BC; does not phosphorylate p53/TP53. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 390 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 543 The length of the canonical sequence.
Location on the sequence: help GHSKILGETSLMRTLCGTPT Y LAPEVLVSVGTAGYNRAVDC The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         GHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDC

Mouse                         GQSKILGETSLMRTLCGTPTYLAPEVLVSNGTAGYSRAVDC

Caenorhabditis elegans        GMAK--NSVNRMKTRCGTPSYNAPEIVANEGVE-YTPKVDI
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 543 Serine/threonine-protein kinase Chk2
Domain 220 – 486 Protein kinase
Region 368 – 394 T-loop/activation segment
Modified residue 379 – 379 Phosphoserine; by autocatalysis
Modified residue 383 – 383 Phosphothreonine; by autocatalysis
Modified residue 387 – 387 Phosphothreonine; by autocatalysis
Alternative sequence 75 – 392 Missing. In isoform 11.
Alternative sequence 107 – 487 Missing. In isoform 3.
Alternative sequence 148 – 543 Missing. In isoform 10.
Alternative sequence 166 – 543 Missing. In isoform 6.
Alternative sequence 204 – 543 Missing. In isoform 5.
Alternative sequence 235 – 543 Missing. In isoform 2.
Alternative sequence 290 – 543 Missing. In isoform 8.
Alternative sequence 340 – 543 Missing. In isoform 7.
Mutagenesis 379 – 379 S -> A. Abrogates autophosphorylation at Ser-379 and prevents ubiquitination.
Mutagenesis 383 – 383 T -> A. Loss of phosphorylation in response to ionizing radiation.
Mutagenesis 387 – 387 T -> A. Loss of phosphorylation in response to ionizing radiation.
Helix 388 – 390



Literature citations
A novel recurrent CHEK2 Y390C mutation identified in high-risk Chinese breast cancer patients impairs its activity and is associated with increased breast cancer risk.
Wang N.; Ding H.; Liu C.; Li X.; Wei L.; Yu J.; Liu M.; Ying M.; Gao W.; Jiang H.; Wang Y.;
Oncogene 34:5198-5205(2015)
Cited for: VARIANT BC CYS-390; CHARACTERIZATION OF VARIANT BC CYS-390; FUNCTION;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.