Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P07911: Variant p.Cys347Gly

Uromodulin
Gene: UMOD
Feedback?
Variant information Variant position: help 347 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Cysteine (C) to Glycine (G) at position 347 (C347G, p.Cys347Gly). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (C) to glycine (G) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In ADTKD1; causes a delay in protein export to the plasma membrane due to a longer retention time in the ER. Any additional useful information about the variant.


Sequence information Variant position: help 347 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 640 The length of the canonical sequence.
Location on the sequence: help SLLEHRLECGANDMKVSLGK C QLKSLGFDKVFMYLSDSRCS The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         SLLEHRLECGANDMKVSLGKCQLKSLGFDKVFMYLSDSRCS

                              FLLD-RLECRPNDIKVSLSKCQLKSLGFEKVFMYLRDSQCS

Mouse                         SQLEYRLECGANDIKMSLRKCQLQSLGFMNVFMYLNDRQCS

Rat                           SLLEHRLECEANEIKISLSKCQLQSLGFMKVFMYLNDRQCS

Bovine                        SLLERRLECGVDDIKLSLSKCQLKSLGFEKVFMYLHDSQCS
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 25 – 614 Uromodulin
Chain 25 – 587 Uromodulin, secreted form
Domain 334 – 589 ZP
Region 334 – 429 ZP-N
Disulfide bond 317 – 347
Disulfide bond 335 – 425
Mutagenesis 333 – 333 L -> K. Abolishes polymerization and filament formation of the secreted form.
Helix 346 – 350



Literature citations
Functional consequences of a novel uromodulin mutation in a family with familial juvenile hyperuricaemic nephropathy.
Tinschert S.; Ruf N.; Bernascone I.; Sacherer K.; Lamorte G.; Neumayer H.H.; Nurnberg P.; Luft F.C.; Rampoldi L.;
Nephrol. Dial. Transplant. 19:3150-3154(2004)
Cited for: VARIANT ADTKD1 GLY-347; CHARACTERIZATION OF VARIANT ADTKD1 GLY-347;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.