Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O15269: Variant p.Ser331Tyr

Serine palmitoyltransferase 1
Gene: SPTLC1
Feedback?
Variant information Variant position: help 331 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Serine (S) to Tyrosine (Y) at position 331 (S331Y, p.Ser331Tyr). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from small size and polar (S) to large size and aromatic (Y) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In ALS27 and HSAN1A; reduced canonical activity towards serine and increased production of deoxysphingolipids. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 331 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 473 The length of the canonical sequence.
Location on the sequence: help LASIGGFCCGRSFVIDHQRL S GQGYCFSASLPPLLAAAAIE The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         LASIGGFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAIE

Mouse                         LASVGGFCCGRSFVVDHQRLSGQGYCFSASLPPLLAAAAIE

Rat                           LASVGGFCCGRSFVVDHQRLSGQGYCFSASLPPLLAAAAIE

Bovine                        LASIGGFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAIE

Caenorhabditis elegans        LASTGGFCVGRSYVVGHQRLSGLGYCFSASLPPLLATAASE

Slime mold                    FSSGGGFCCGSPEVVYHQRLNGVGYVFSASLPPFLACSSTK

Baker's yeast                 LGSTGGFVLGDSVMCLHQRIGSNAYCFSACLPAYTVTSVSK

Fission yeast                 LAGGGGFCAGSELMVEHQRLSGMAYIYSAALPASLAVAAYE

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 473 Serine palmitoyltransferase 1
Topological domain 37 – 473 Cytoplasmic
Alternative sequence 144 – 473 Missing. In isoform 2.
Mutagenesis 337 – 337 F -> A. Strongly decreased catalytic activity with L-serine and palmitoyl-CoA as substrates.
Mutagenesis 338 – 338 S -> A. Decreased catalytic activity with L-serine and palmitoyl-CoA as substrates.
Helix 322 – 331



Literature citations
Mutations at Ser331 in the HSN type I gene SPTLC1 are associated with a distinct syndromic phenotype.
Auer-Grumbach M.; Bode H.; Pieber T.R.; Schabhuettl M.; Fischer D.; Seidl R.; Graf E.; Wieland T.; Schuh R.; Vacariu G.; Grill F.; Timmerman V.; Strom T.M.; Hornemann T.;
Eur. J. Med. Genet. 56:266-269(2013)
Cited for: INVOLVEMENT IN HSAN1A; VARIANT HSAN1A TYR-331; CHARACTERIZATION OF VARIANT HSAN1A TYR-331;
Association of Variants in the SPTLC1 Gene With Juvenile Amyotrophic Lateral Sclerosis.
Johnson J.O.; Chia R.; Miller D.E.; Li R.; Kumaran R.; Abramzon Y.; Alahmady N.; Renton A.E.; Topp S.D.; Gibbs J.R.; Cookson M.R.; Sabir M.S.; Dalgard C.L.; Troakes C.; Jones A.R.; Shatunov A.; Iacoangeli A.; Al Khleifat A.; Ticozzi N.; Silani V.; Gellera C.; Blair I.P.; Dobson-Stone C.; Kwok J.B.; Bonkowski E.S.; Palvadeau R.; Tienari P.J.; Morrison K.E.; Shaw P.J.; Al-Chalabi A.; Brown R.H. Jr.; Calvo A.; Mora G.; Al-Saif H.; Gotkine M.; Leigh F.; Chang I.J.; Perlman S.J.; Glass I.; Scott A.I.; Shaw C.E.; Basak A.N.; Landers J.E.; Chio A.; Crawford T.O.; Smith B.N.; Traynor B.J.; Smith B.N.; Ticozzi N.; Fallini C.; Gkazi A.S.; Topp S.D.; Scotter E.L.; Kenna K.P.; Keagle P.; Tiloca C.; Vance C.; Troakes C.; Colombrita C.; King A.; Pensato V.; Castellotti B.; Baas F.; Ten Asbroek A.L.M.A.; McKenna-Yasek D.; McLaughlin R.L.; Polak M.; Asress S.; Esteban-Perez J.; Stevic Z.; D'Alfonso S.; Mazzini L.; Comi G.P.; Del Bo R.; Ceroni M.; Gagliardi S.; Querin G.; Bertolin C.; van Rheenen W.; Rademakers R.; van Blitterswijk M.; Lauria G.; Duga S.; Corti S.; Cereda C.; Corrado L.; Soraru G.; Williams K.L.; Nicholson G.A.; Blair I.P.; Leblond-Manry C.; Rouleau G.A.; Hardiman O.; Morrison K.E.; Veldink J.H.; van den Berg L.H.; Al-Chalabi A.; Pall H.; Shaw P.J.; Turner M.R.; Talbot K.; Taroni F.; Garcia-Redondo A.; Wu Z.; Glass J.D.; Gellera C.; Ratti A.; Brown R.H. Jr.; Silani V.; Shaw C.E.; Landers J.E.; Dalgard C.L.; Adeleye A.; Soltis A.R.; Alba C.; Viollet C.; Bacikova D.; Hupalo D.N.; Sukumar G.; Pollard H.B.; Wilkerson M.D.; Martinez E.M.; Abramzon Y.; Ahmed S.; Arepalli S.; Baloh R.H.; Bowser R.; Brady C.B.; Brice A.; Broach J.; Campbell R.H.; Camu W.; Chia R.; Cooper-Knock J.; Ding J.; Drepper C.; Drory V.E.; Dunckley T.L.; Eicher J.D.; England B.K.; Faghri F.; Feldman E.; Floeter M.K.; Fratta P.; Geiger J.T.; Gerhard G.; Gibbs J.R.; Gibson S.B.; Glass J.D.; Hardy J.; Harms M.B.; Heiman-Patterson T.D.; Hernandez D.G.; Jansson L.; Kirby J.; Kowall N.W.; Laaksovirta H.; Landeck N.; Landi F.; Le Ber I.; Lumbroso S.; MacGowan D.J.L.; Maragakis N.J.; Mora G.; Mouzat K.; Murphy N.A.; Myllykangas L.; Nalls M.A.; Orrell R.W.; Ostrow L.W.; Pamphlett R.; Pickering-Brown S.; Pioro E.P.; Pletnikova O.; Pliner H.A.; Pulst S.M.; Ravits J.M.; Renton A.E.; Rivera A.; Robberecht W.; Rogaeva E.; Rollinson S.; Rothstein J.D.; Scholz S.W.; Sendtner M.; Shaw P.J.; Sidle K.C.; Simmons Z.; Singleton A.B.; Smith N.; Stone D.J.; Tienari P.J.; Troncoso J.C.; Valori M.; Van Damme P.; Van Deerlin V.M.; Van Den Bosch L.; Zinman L.; Landers J.E.; Chio A.; Traynor B.J.; Angelocola S.M.; Ausiello F.P.; Barberis M.; Bartolomei I.; Battistini S.; Bersano E.; Bisogni G.; Borghero G.; Brunetti M.; Cabona C.; Calvo A.; Canale F.; Canosa A.; Cantisani T.A.; Capasso M.; Caponnetto C.; Cardinali P.; Carrera P.; Casale F.; Chio A.; Colletti T.; Conforti F.L.; Conte A.; Conti E.; Corbo M.; Cuccu S.; Dalla Bella E.; D'Errico E.; DeMarco G.; Dubbioso R.; Ferrarese C.; Ferraro P.M.; Filippi M.; Fini N.; Floris G.; Fuda G.; Gallone S.; Gianferrari G.; Giannini F.; Grassano M.; Greco L.; Iazzolino B.; Introna A.; La Bella V.; Lattante S.; Lauria G.; Liguori R.; Logroscino G.; Logullo F.O.; Lunetta C.; Mandich P.; Mandrioli J.; Manera U.; Manganelli F.; Marangi G.; Marinou K.; Marrosu M.G.; Martinelli I.; Messina S.; Moglia C.; Mora G.; Mosca L.; Murru M.R.; Origone P.; Passaniti C.; Petrelli C.; Petrucci A.; Pozzi S.; Pugliatti M.; Quattrini A.; Ricci C.; Riolo G.; Riva N.; Russo M.; Sabatelli M.; Salamone P.; Salivetto M.; Salvi F.; Santarelli M.; Sbaiz L.; Sideri R.; Simone I.; Simonini C.; Spataro R.; Tanel R.; Tedeschi G.; Ticca A.; Torriello A.; Tranquilli S.; Tremolizzo L.; Trojsi F.; Vasta R.; Vacchiano V.; Vita G.; Volanti P.; Zollino M.; Zucchi E.;
JAMA Neurol. 78:1236-1248(2021)
Cited for: INVOLVEMENT IN ALS27; VARIANTS ALS27 SER-20; LEU-39 DEL AND TYR-331;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.