Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9Y3A0: Variant p.Arg240Cys

Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial
Gene: COQ4
Feedback?
Variant information Variant position: help 240 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Arginine (R) to Cysteine (C) at position 240 (R240C, p.Arg240Cys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to medium size and polar (C) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In COQ10D7; likely pathogenic; does not support cell growth in a yeast complementation assay suggesting loss of function. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 240 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 265 The length of the canonical sequence.
Location on the sequence: help PWAVQNGRRAPCVLNLYYER R WEQSLRALREELGITAPPMH The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         PWAVQNGRRAPCVLNLYYERRWEQSLRALREELGITAPPMH

Mouse                         PWAIQNGRRAPCVLNIYYEQRWEQPLTALREELGISPPPKH

Rat                           PWAIQNGRRAPCVLNIYYEQRWEQPLTALREELGISPPPKH

Bovine                        PWAVENGRRAPCVLNVYYERRWEQPLQALRQELGITEPPLR

Xenopus laevis                PWAVQSGRNARCVLNFHYENRWEQSVLSLRKEIGILPLPEI

Xenopus tropicalis            PWAVQSGRNARCVLNFYYEKRWGQSVASLREEIGILPPPEI

Zebrafish                     LWALRNGGRARCVLSIYYERRWEQTLDELRHELNIEEPPVS

Caenorhabditis elegans        PWVVEQATNARFFMAFDWENHFEKQLSEVQKELNITPLSVN

Drosophila                    PWALENGKRTKPLMPVYWEKRWEQNIHELRSELGITVLNKA

Slime mold                    PWAIKSSKSCVYLMNVKYEDHWEDDLNEFRAKLNFIPYKYL

Baker's yeast                 PWAVRTGLSCKPLINVYWEEMLEKDVTALRKELKITLPPDL

Fission yeast                 PWSIRNGLNAKTLINVYWEKELTNDIEDVRRRIRIEAAPPL

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 31 – 265 Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial



Literature citations
COQ4 mutations cause a broad spectrum of mitochondrial disorders associated with CoQ10 deficiency.
Brea-Calvo G.; Haack T.B.; Karall D.; Ohtake A.; Invernizzi F.; Carrozzo R.; Kremer L.; Dusi S.; Fauth C.; Scholl-Burgi S.; Graf E.; Ahting U.; Resta N.; Laforgia N.; Verrigni D.; Okazaki Y.; Kohda M.; Martinelli D.; Freisinger P.; Strom T.M.; Meitinger T.; Lamperti C.; Lacson A.; Navas P.; Mayr J.A.; Bertini E.; Murayama K.; Zeviani M.; Prokisch H.; Ghezzi D.;
Am. J. Hum. Genet. 96:309-317(2015)
Cited for: INVOLVEMENT IN COQ10D7; VARIANTS COQ10D7 SER-52; SER-64; 141-ARG--ALA-265 DEL; GLY-145; THR-174 DEL AND CYS-240;
A comprehensive genomic analysis reveals the genetic landscape of mitochondrial respiratory chain complex deficiencies.
Kohda M.; Tokuzawa Y.; Kishita Y.; Nyuzuki H.; Moriyama Y.; Mizuno Y.; Hirata T.; Yatsuka Y.; Yamashita-Sugahara Y.; Nakachi Y.; Kato H.; Okuda A.; Tamaru S.; Borna N.N.; Banshoya K.; Aigaki T.; Sato-Miyata Y.; Ohnuma K.; Suzuki T.; Nagao A.; Maehata H.; Matsuda F.; Higasa K.; Nagasaki M.; Yasuda J.; Yamamoto M.; Fushimi T.; Shimura M.; Kaiho-Ichimoto K.; Harashima H.; Yamazaki T.; Mori M.; Murayama K.; Ohtake A.; Okazaki Y.;
PLoS Genet. 12:E1005679-E1005679(2016)
Cited for: VARIANT COQ10D7 CYS-240;
New pathogenic variants in COQ4 cause ataxia and neurodevelopmental disorder without detectable CoQ10 deficiency in muscle or skin fibroblasts.
Mero S.; Salviati L.; Leuzzi V.; Rubegni A.; Calderan C.; Nardecchia F.; Galatolo D.; Desbats M.A.; Naef V.; Gemignani F.; Novelli M.; Tessa A.; Battini R.; Santorelli F.M.; Marchese M.;
J. Neurol. 268:3381-3389(2021)
Cited for: VARIANTS COQ10D7 ASP-95; HIS-102; SER-193 AND CYS-240; CHARACTERIZATION OF COQ10D7 ASP-95; HIS-102; SER-193 AND CYS-240;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.