Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P35498: Variant p.Tyr1462His

Sodium channel protein type 1 subunit alpha
Gene: SCN1A
Feedback?
Variant information Variant position: help 1462 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Tyrosine (Y) to Histidine (H) at position 1462 (Y1462H, p.Tyr1462His). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and aromatic (Y) to medium size and polar (H) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In DRVT and ICEGTC; borderline DRVT phenotype. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 1462 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 2009 The length of the canonical sequence.
Location on the sequence: help VDSRNVELQPKYEESLYMYL Y FVIFIIFGSFFTLNLFIGVI The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         VDSRNVELQPKYEESLYMYLYFVIFIIFGSFFTLNLFIGVI

Mouse                         VDSRNVELQPKYEESLYMYLYFVIFIIFGSFFTLNLFIGVI

Rat                           VDSRNVELQPKYEESLYMYLYFVIFIIFGSFFTLNLFIGVI

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 2009 Sodium channel protein type 1 subunit alpha
Transmembrane 1458 – 1483 Helical; Name=S6 of repeat III
Repeat 1200 – 1514 III
Helix 1460 – 1466



Literature citations
Dravet syndrome as epileptic encephalopathy: evidence from long-term course and neuropathology.
Catarino C.B.; Liu J.Y.; Liagkouras I.; Gibbons V.S.; Labrum R.W.; Ellis R.; Woodward C.; Davis M.B.; Smith S.J.; Cross J.H.; Appleton R.E.; Yendle S.C.; McMahon J.M.; Bellows S.T.; Jacques T.S.; Zuberi S.M.; Koepp M.J.; Martinian L.; Scheffer I.E.; Thom M.; Sisodiya S.M.;
Brain 134:2982-3010(2011)
Cited for: VARIANTS DRVT LYS-226; HIS-931; ALA-1266; HIS-1462; THR-1523; THR-1638 AND GLU-1880;
Genotype-phenotype associations in SCN1A-related epilepsies.
Zuberi S.M.; Brunklaus A.; Birch R.; Reavey E.; Duncan J.; Forbes G.H.;
Neurology 76:594-600(2011)
Cited for: VARIANTS DRVT PHE-17 DEL; THR-68; ASN-79; CYS-84; PRO-98; GLN-101; TRP-101; ARG-108; ASP-127; ARG-199; SER-227; THR-227; SER-232; ARG-233; VAL-342; ASP-343; TRP-351; SER-359; ARG-363; ARG-384; CYS-393; HIS-393; VAL-400; VAL-403; PHE-406; GLY-626; ASP-762; THR-785; ILE-812; ARG-842; 854-GLY-LEU-855 DEL; CYS-859; GLN-862; PRO-890; CYS-932; PRO-933; CYS-946; HIS-946; ARG-950; LYS-954; LYS-956; LEU-957; ILE-976; VAL-979; ARG-993; 999-ASN-LEU-1000 DELINS LEU-ILE-SER; LYS-1208; LYS-1221; PHE-1230; ASP-1238; ALA-1266; ASN-1288; VAL-1320; PRO-1326; GLY-1350; ARG-1358; PRO-1370; HIS-1378; THR-1378; ILE-1394; TYR-1396; SER-1417; PHE-1423; ALA-1429 DEL; VAL-1433; LYS-1450; SER-1451; LYS-1454; HIS-1462; LYS-1476; LYS-1503; GLY-1544; GLU-1586; ARG-1588; HIS-1592; PRO-1592; SER-1605; GLU-1637; THR-1638; CYS-1648; GLU-1653; PRO-1660; PRO-1667; LEU-1668; ILE-1672; THR-1673; THR-1683; ASP-1684; TRP-1688; ARG-1714; ASN-1763; ASN-1770; PHE-1770; THR-1770; THR-1780; VAL-1783; LYS-1787; PRO-1832; LYS-1852; LEU-1855; GLU-1880; THR-1909 DEL AND ARG-1927 DELINS ILE-ILE-GLN; VARIANTS GEFSP2 LEU-218; ILE-254; GLY-291; THR-960; VAL-973; SER-1204; PHE-1230; ASP-1414; HIS-1596; LEU-1739 AND THR-1867; VARIANTS ASN-45; VAL-333; ASN-382; HIS-604; ILE-699; THR-924; HIS-931; GLU-1006; ILE-1079; THR-1109; ASP-1308; ASP-1326; MET-1483 AND PHE-1683;
Prevalence of SCN1A mutations in children with suspected Dravet syndrome and intractable childhood epilepsy.
Wang J.W.; Shi X.Y.; Kurahashi H.; Hwang S.K.; Ishii A.; Higurashi N.; Kaneko S.; Hirose S.;
Epilepsy Res. 102:195-200(2012)
Cited for: VARIANTS DRVT CYS-84; GLN-101; TRP-101; ILE-105; ARG-179; ARG-190; ARG-226; SER-227; ARG-259; ARG-280; ALA-281; PRO-363; ARG-384; HIS-393; TRP-409; CYS-426; MET-875; ILE-876; PHE-896; ILE-934; PHE-940; CYS-946; HIS-946; LEU-987; GLY-1316; VAL-1339; MET-1344; PRO-1355; VAL-1385; GLY-1418; PRO-1427; CYS-1453; HIS-1462; SER-1472; TYR-1485; GLU-1503 DEL; LYS-1503; VAL-1545; ARG-1555; GLY-1608; LEU-1630; ASN-1638; SER-1642; VAL-1662; PRO-1667; PHE-1677; THR-1683; SER-1692; CYS-1694; GLY-1727; ARG-1741; PHE-1766 DEL; PHE-1771; THR-1783; VAL-1783 AND THR-1792; VARIANTS ICEGTC SER-90; GLN-101; SER-178; MET-252; ARG-290; HIS-393; ILE-896; ALA-944; GLN-1213; CYS-1254; THR-1325; PRO-1328; LEU-1357; ARG-1376; ASP-1429; HIS-1462; LYS-1511; VAL-1619; SER-1684; PRO-1724; CYS-1781 AND TRP-1861; VARIANTS GLN-542 AND CYS-1575;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.