Home  |  Contact

UniProtKB/Swiss-Prot Q9UHD2: Variant p.Glu696Lys

Serine/threonine-protein kinase TBK1
Gene: TBK1
Chromosomal location: 12q14.1
Variant information

Variant position:  696
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Glutamate (E) to Lysine (K) at position 696 (E696K, p.Glu696Lys).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and acidic (E) to large size and basic (K)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Frontotemporal dementia and/or amyotrophic lateral sclerosis 4 (FTDALS4) [MIM:616439]: A neurodegenerative disorder characterized by frontotemporal dementia and/or amyotrophic lateral sclerosis in affected individuals. There is high intrafamilial variation. Frontotemporal dementia is characterized by frontal and temporal lobe atrophy associated with neuronal loss, gliosis, and dementia. Patients exhibit progressive changes in social, behavioral, and/or language function. Amyotrophic lateral sclerosis is characterized by the death of motor neurons in the brain, brainstem, and spinal cord, resulting in fatal paralysis. {ECO:0000269|PubMed:25803835, ECO:0000269|PubMed:25943890}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In FTDALS4; loss of kinase activity; impairs binding to OPTN.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  696
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  729
The length of the canonical sequence.

Location on the sequence:   IYPSSNTLVEMTLGMKKLKE  E MEGVVKELAENNHILERFGS
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         IYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGS

Mouse                         IYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGS

Xenopus laevis                IYSSPNTLVEMTLGMRKLKEDMEGVVKELEENNHILERFGA

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 729 Serine/threonine-protein kinase TBK1
Coiled coil 658 – 713
Modified residue 716 – 716 Phosphoserine
Mutagenesis 690 – 690 M -> A. Decreases interaction with TANK.
Mutagenesis 693 – 693 L -> A. Almost abolishes interaction with TANK.
Mutagenesis 694 – 694 K -> E. Strongly decreases interaction with TANK and TBKBP1. No effect on phosphorylation.
Mutagenesis 704 – 704 L -> A. Strongly decreases interaction with AZI2, TANK and TBKBP1. No effect on phosphorylation.
Mutagenesis 708 – 708 N -> A. Decreases interaction with TANK.
Mutagenesis 711 – 711 L -> A. Almost abolishes interaction with TANK.
Helix 680 – 714


Literature citations

Whole-genome sequencing reveals important role for TBK1 and OPTN mutations in frontotemporal lobar degeneration without motor neuron disease.
Pottier C.; Bieniek K.F.; Finch N.; van de Vorst M.; Baker M.; Perkersen R.; Brown P.; Ravenscroft T.; van Blitterswijk M.; Nicholson A.M.; DeTure M.; Knopman D.S.; Josephs K.A.; Parisi J.E.; Petersen R.C.; Boylan K.B.; Boeve B.F.; Graff-Radford N.R.; Veltman J.A.; Gilissen C.; Murray M.E.; Dickson D.W.; Rademakers R.;
Acta Neuropathol. 130:77-92(2015)
Cited for: INVOLVEMENT IN FTDALS4; VARIANTS FTDALS4 ILE-306; GLU-401 AND LYS-696;

Haploinsufficiency of TBK1 causes familial ALS and fronto-temporal dementia.
Freischmidt A.; Wieland T.; Richter B.; Ruf W.; Schaeffer V.; Mueller K.; Marroquin N.; Nordin F.; Huebers A.; Weydt P.; Pinto S.; Press R.; Millecamps S.; Molko N.; Bernard E.; Desnuelle C.; Soriani M.H.; Dorst J.; Graf E.; Nordstroem U.; Feiler M.S.; Putz S.; Boeckers T.M.; Meyer T.; Winkler A.S.; Winkelman J.; de Carvalho M.; Thal D.R.; Otto M.; Braennstroem T.; Volk A.E.; Kursula P.; Danzer K.M.; Lichtner P.; Dikic I.; Meitinger T.; Ludolph A.C.; Strom T.M.; Andersen P.M.; Weishaupt J.H.;
Nat. Neurosci. 18:631-636(2015)
Cited for: INVOLVEMENT IN FTDALS4; VARIANTS FTDALS4 HIS-47; CYS-105; THR-305; GLN-308; GLN-357; ARG-559; VAL-571; VAL-598; GLU-643 DEL AND LYS-696; CHARACTERIZATION OF VARIANTS FTDALS4 HIS-47; GLN-308; GLN-357; ARG-559 AND LYS-696;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.