UniProtKB/SwissProt variant VAR

Variant information

Variant position:

424

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:

Disease [Disclaimer]

The variants are classified into three categories: Disease, Polymorphism and Unclassified.

Disease: Variants implicated in disease according to literature reports.
Polymorphism: Variants not reported to be implicated in disease.
Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:

From Tyrosine (Y) to Histidine (H) at position 424 (Y424H, p.Tyr424His).

Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:

Change from large size and aromatic (Y) to medium size and polar (H)

The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:

2

The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page

Involvement in disease:

Dyschromatosis universalis hereditaria 3 (DUH3) [MIM:615402]: An autosomal dominant pigmentary genodermatosis characterized by a mixture of hyperpigmented and hypopigmented macules distributed randomly over the body, that appear in infancy or early childhood. The trunk and extremities are the dominant sites of abnormal pigmentation. Facial lesions can be seen in 50% of affected individuals, but involvement of palms and soles is unusual. Abnormalities of hair and nails have also been reported. Dyschromatosis universalis hereditaria may be associated with abnormalities of dermal connective tissue, nerve tissue, or other systemic complications. {ECO:0000269|PubMed:23519333, ECO:0000269|PubMed:24224009, ECO:0000269|PubMed:24498303, ECO:0000269|PubMed:25288164}. Note=The disease is caused by mutations affecting the gene represented in this entry.

The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:

In DUH3.

Any additional useful information about the variant.

Sequence information

Variant position:

424

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:

842

The length of the canonical sequence.

Location on the sequence:

YFSMFFNAWFGLIVFLCMSL Y LTLTIVVTEWRTKFRRAMNT

The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         YFSMFFNAWFGLIVFLCMSLYLTLTIVVTEWRTKFRRAMNT

Mouse                         YFSMFFNAWFGLIVFLCMSLYLILTIVVTEWRAKFRRDMNT

Rat                           YFSMFFNAWFGLIVFLCMSLYLILTIMVTEWRAKFRRDMNT

Xenopus tropicalis            YFTSSFNAWFGLIIFVCMTLYLTLTIIITEWRTKYRREMNT

Slime mold                    FLLFSYGAEFAFINLTSCVVYIAFTLYVTERRTKHRRLANK

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 842	ATP-binding cassette sub-family B member 6, mitochondrial
Transmembrane	409 – 431	Helical
Domain	265 – 556	ABC transmembrane type-1

Literature citations

Novel missense mutations of ABCB6 in two chinese families with dyschromatosis universalis hereditaria.
Lu C.; Liu J.; Liu F.; Liu Y.; Ma D.; Zhang X.;
J. Dermatol. Sci. 76:255-258(2014)
Cited for: VARIANTS DUH3 ARG-322 AND HIS-424;

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9NP58: Variant p.Tyr424His