Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q03252: Variant p.Tyr252His

Lamin-B2
Gene: LMNB2
Feedback?
Variant information Variant position: help 252 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Tyrosine (Y) to Histidine (H) at position 252 (Y252H, p.Tyr252His). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and aromatic (Y) to medium size and polar (H) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In APLD. Any additional useful information about the variant.


Sequence information Variant position: help 252 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 620 The length of the canonical sequence.
Location on the sequence: help ETRRRHERRLVEVDSSRQQE Y DFKMAQALEELRSQHDEQVR The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         ETRRRHERRLVEVDSSRQQEYDFKMAQALEELRSQHDEQVR

Mouse                         ETRRRHERRLVEVDSSRQQEYDFKMAQALEDLRSQHDEQVR

Chicken                       ETRKRHEHRLVEVDTSRQQEYENKMAQALEDLRNQHDEQVK

Xenopus laevis                ETRKRHERRIVEVDRGHHYDYESKLAQALDELRKQHDEQVK
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 617 Lamin-B2
Domain 46 – 402 IF rod
Region 230 – 256 Linker 2
Cross 255 – 255 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)



Literature citations
A Chinese patient with acquired partial lipodystrophy caused by a novel mutation with LMNB2 gene.
Gao J.; Li Y.; Fu X.; Luo X.;
J. Pediatr. Endocrinol. Metab. 25:375-377(2012)
Cited for: VARIANT APLD HIS-252;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.