Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O15554: Variant p.Val282Met

Intermediate conductance calcium-activated potassium channel protein 4
Gene: KCNN4
Feedback?
Variant information Variant position: help 282 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Valine (V) to Methionine (M) at position 282 (V282M, p.Val282Met). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In DHS2. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 282 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 427 The length of the canonical sequence.
Location on the sequence: help WGKIVCLCTGVMGVCCTALL V AVVARKLEFNKAEKHVHNFM The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         WGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHNFM

Mouse                         WGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHNFM

Rat                           WGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHNFM
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 427 Intermediate conductance calcium-activated potassium channel protein 4
Transmembrane 265 – 285 Helical; Name=Segment S6
Mutagenesis 275 – 275 V -> A. Loss of sensitivity to triarylmethanes.
Helix 261 – 287



Literature citations
Novel Gardos channel mutations linked to dehydrated hereditary stomatocytosis (xerocytosis).
Andolfo I.; Russo R.; Manna F.; Shmukler B.E.; Gambale A.; Vitiello G.; De Rosa G.; Brugnara C.; Alper S.L.; Snyder L.M.; Iolascon A.;
Am. J. Hematol. 90:921-926(2015)
Cited for: VARIANTS DHS2 MET-282 AND HIS-352; Mutations in the Gardos channel (KCNN4) are associated with hereditary xerocytosis.
Glogowska E.; Lezon-Geyda K.; Maksimova Y.; Schulz V.P.; Gallagher P.G.;
Blood 126:1281-1284(2015)
Cited for: VARIANTS DHS2 GLU-282 AND MET-282;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.