Home  |  Contact

UniProtKB/Swiss-Prot O60930: Variant p.Ala185Val

Ribonuclease H1
Gene: RNASEH1
Variant information

Variant position:  185
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Alanine (A) to Valine (V) at position 185 (A185V, p.Ala185Val).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from small size and hydrophobic (A) to medium size and hydrophobic (V)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Progressive external ophthalmoplegia with mitochondrial DNA deletions, autosomal recessive 2 (PEOB2) [MIM:616479]: A form of progressive external ophthalmoplegia, a mitochondrial myopathy characterized by progressive paralysis of the levator palpebrae, orbicularis oculi, and extraocular muscles. PEOB2 patients manifest exercise intolerance, muscle weakness, and signs and symptoms of spinocerebellar ataxia, such as impaired gait and dysarthria. Some patients may have respiratory insufficiency. {ECO:0000269|PubMed:26094573}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In PEOB2; has partial residual endonuclease activity.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  185
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  286
The length of the canonical sequence.

Location on the sequence:   GPGHPLNVGIRLPGRQTNQR  A EIHAACKAIEQAKTQNINKL
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         GPGHPLNVGIRL-PGRQTNQRAEIHAACKAIEQAKTQNINKL

Mouse                         GPGHPLNVGIRL-PGRQTNQRAEIHAACKAIMQAKAQNISK

Rat                           GPGHPLNVGIRL-PGRQTNQRAEIHAACKAITQAKAQNISK

Baker's yeast                 EGAPEENISEPLLSGAQTNNRAEIEAVSEALKKIW----EK

Fission yeast                 GNDDPRNISVPLAGEEQTNNRAELQAIILALENTS----GD

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 286 Ribonuclease H1
Domain 136 – 282 RNase H
Metal binding 186 – 186 Magnesium 1
Helix 182 – 199


Literature citations

RNASEH1 mutations impair mtDNA replication and cause adult-onset mitochondrial encephalomyopathy.
Reyes A.; Melchionda L.; Nasca A.; Carrara F.; Lamantea E.; Zanolini A.; Lamperti C.; Fang M.; Zhang J.; Ronchi D.; Bonato S.; Fagiolari G.; Moggio M.; Ghezzi D.; Zeviani M.;
Am. J. Hum. Genet. 97:186-193(2015)
Cited for: INVOLVEMENT IN PEOB2; VARIANTS PEOB2 ILE-142 AND VAL-185; CHARACTERIZATION OF VARIANTS PEOB2 ILE-142 AND VAL-185;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.