UniProtKB/Swiss-Prot A2RRP1: Variant p.Arg137Trp

NBAS subunit of NRZ tethering complex
Gene: NBAS
Feedback?

Variant information Variant position:

137 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Arginine (R) to Tryptophan (W) at position 137 (R137W, p.Arg137Trp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from large size and basic (R) to large size and aromatic (W) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

Found in patients with a multisystem disease involving liver, eye, immune system, connective tissue and bone; likely pathogenic. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs368085185 [ dbSNP | Ensembl ]

Sequence information Variant position:

137 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

2371 The length of the canonical sequence.
Location on the sequence:

DFTSIIGKCQVPKDPKPQWR R VAWSYDCTLLAYAESTGTVR The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         DFTSIIGKCQVPKDPKPQWRRVAWSYDCTLLAYAESTGTVR

Zebrafish                     DFGSIIGKCQVPKDPNPHWRRVAWSHDCALLAYADSTGTVR

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 2371	NBAS subunit of NRZ tethering complex
Repeat	130 – 169	WD 1
Region	1 – 1035	Interaction with USE1

Literature citations
NBAS mutations cause a multisystem disorder involving bone, connective tissue, liver, immune system, and retina.
Garcia Segarra N.; Ballhausen D.; Crawford H.; Perreau M.; Campos-Xavier B.; van Spaendonck-Zwarts K.; Vermeer C.; Russo M.; Zambelli P.Y.; Stevenson B.; Royer-Bertrand B.; Rivolta C.; Candotti F.; Unger S.; Munier F.L.; Superti-Furga A.; Bonafe L.;
Am. J. Med. Genet. A 167:2902-2912(2015)
Cited for: INVOLVEMENT IN MULTISYSTEM DISEASE; VARIANTS VAL-95; TRP-137 AND ARG-396;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.