Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q5JTJ3: Variant p.Trp59Cys

Cytochrome c oxidase assembly factor 6 homolog
Gene: COA6
Feedback?
Variant information Variant position: help 59 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Tryptophan (W) to Cysteine (C) at position 59 (W59C, p.Trp59Cys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and aromatic (W) to medium size and polar (C) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In MC4DN13; mistargeted to the mitochondrial matrix; loss of interaction with SCO2 and MT-CO2. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 59 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 125 The length of the canonical sequence.
Location on the sequence: help ALSFIAVGMAAPSMKERQVC W GARDEYWKCLDENLEDASQC The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         ALSFIAVGMAAPSMKERQVCWGARDEYWKCLD-----------ENLEDASQC

Mouse                         --------MAAPSMKERQACWGARDLYWRCLD---------

Bovine                        --------MAAPTMKERQACWGARDEYWKCLD---------

Baker's yeast                 FDGGKKESQPPNTRSQRKLCWESRDAFFQCLDKADILDAMD

Fission yeast                 -----MAGNGALRRSAREKCWEARDAYFGCLDRHSILDGL-
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 125 Cytochrome c oxidase assembly factor 6 homolog
Domain 55 – 98 CHCH
Motif 58 – 68 Cx9C motif
Disulfide bond 58 – 90
Helix 53 – 71



Literature citations
Copper supplementation restores cytochrome c oxidase assembly defect in a mitochondrial disease model of COA6 deficiency.
Ghosh A.; Trivedi P.P.; Timbalia S.A.; Griffin A.T.; Rahn J.J.; Chan S.S.; Gohil V.M.;
Hum. Mol. Genet. 23:3596-3606(2014)
Cited for: FUNCTION; INVOLVEMENT IN MC4DN13; VARIANT MC4DN13 CYS-59; Cooperation between COA6 and SCO2 in COX2 maturation during cytochrome c oxidase assembly links two mitochondrial cardiomyopathies.
Pacheu-Grau D.; Bareth B.; Dudek J.; Juris L.; Voegtle F.N.; Wissel M.; Leary S.C.; Dennerlein S.; Rehling P.; Deckers M.;
Cell Metab. 21:823-833(2015)
Cited for: FUNCTION; SUBCELLULAR LOCATION; INTERACTION WITH MT-CO2 AND SCO2; CHARACTERIZATION OF VARIANT MC4DN13 CYS-59;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.