Sequence information
Variant position: 28 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: 2221 The length of the canonical sequence.
Location on the sequence:
MYIPEENHQGSNYGSPRPAH
A NMNANAAAGLAPEHIPTPGA
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human MYIPEENH--------------------------QGSNYGSPRPAHA NMNANAAAGLAPEHIPTPGA
Mouse MYVPEENH--------------------------QGSNYGS
Rat PYQPLSSCLSEDTERKFKGKVVHEAQLNCFYISPGGSNYGS
Rabbit AYQPLPSHLSAETESTCKGTVVHEAQLNHFYISPGGSNYGS
Sequence annotation in neighborhood: The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:Type: the type of sequence feature. Positions: endpoints of the sequence feature. Description: contains additional information about the feature.
Type Positions Description
Chain
1 – 2221
Voltage-dependent L-type calcium channel subunit alpha-1C
Topological domain
1 – 124
Cytoplasmic
Alternative sequence
1 – 29
Missing. In isoform 16, isoform 17, isoform 18 and isoform 28.
Literature citations
Gain-of-function mutations in the calcium channel CACNA1C (Cav1.2) cause non-syndromic long-QT but not Timothy syndrome.
Wemhoener K.; Friedrich C.; Stallmeyer B.; Coffey A.J.; Grace A.; Zumhagen S.; Seebohm G.; Ortiz-Bonnin B.; Rinne S.; Sachse F.B.; Schulze-Bahr E.; Decher N.;
J. Mol. Cell. Cardiol. 80:186-195(2015)
Cited for: VARIANTS LQT8 THR-28; LYS-477; GLY-860; THR-1186; VAL-1186; THR-1365; MET-1523; LYS-1544; ASN-1787; ILE-1800; LYS-1948; MET-1953 ASN-2081; ILE-2097 AND GLY-2122; CHARACTERIZATION OF VARIANTS LQT8 THR-28; GLY-860; THR-1186; VAL-1186; MET-1523 AND LYS-1544; VARIANTS ARG-37; THR-304; SER-817; ILE-1755; GLY-1765; MET-1835; ARG-1843; CYS-1972; GLN-2056 AND SER-2174;
Disclaimer:
Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.