Home  |  Contact

UniProtKB/Swiss-Prot Q9UI33: Variant p.Val1184Ala

Sodium channel protein type 11 subunit alpha
Gene: SCN11A
Variant information

Variant position:  1184
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Valine (V) to Alanine (A) at position 1184 (V1184A, p.Val1184Ala).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and hydrophobic (V) to small size and hydrophobic (A)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Neuropathy, hereditary sensory and autonomic, 7 (HSAN7) [MIM:615548]: A form of hereditary sensory and autonomic neuropathy, a genetically and clinically heterogeneous group of disorders characterized by degeneration of dorsal root and autonomic ganglion cells, and by sensory and/or autonomic abnormalities. HSAN7 is characterized by congenital inability to experience pain resulting in self-mutilations, slow-healing wounds, and multiple painless fractures. Mild muscle weakness, delayed motor development, slightly reduced motor and sensory nerve conduction velocities, hyperhidrosis and gastrointestinal dysfunction. {ECO:0000269|PubMed:24036948, ECO:0000269|PubMed:26645915}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In HSAN7; cold-aggravated peripheral pain seen in some patients; enhances the channel activity by shifting the voltage dependence of channel opening to hyperpolarized potentials thereby giving rise to hyperexcitability of nociceptors; causes hyperexcitability and reduced cold-sensitivity of dorsal root ganglion neurons.
Any additional useful information about the variant.



Sequence information

Variant position:  1184
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1791
The length of the canonical sequence.

Location on the sequence:   MKVVVNALIGAIPAILNVLL  V CLIFWLVFCILGVYFFSGKF
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         MKVVVNALIGAIPAILNVLLVCLIFWLVFCILGVYFFSGKF

Mouse                         MKVVVNALMSAIPAILNVLLVCLIFWLIFCILGVNFFSGKF

Rat                           MKVVVYALISAIPAILNVLLVCLIFWLVFCILGVNLFSGKF

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 1791 Sodium channel protein type 11 subunit alpha
Transmembrane 1181 – 1202 Helical; Name=S5 of repeat III
Repeat 1044 – 1339 III


Literature citations

Cold-aggravated pain in humans caused by a hyperactive NaV1.9 channel mutant.
Leipold E.; Hanson-Kahn A.; Frick M.; Gong P.; Bernstein J.A.; Voigt M.; Katona I.; Oliver Goral R.; Altmueller J.; Nuernberg P.; Weis J.; Huebner C.A.; Heinemann S.H.; Kurth I.;
Nat. Commun. 6:10049-10049(2015)
Cited for: VARIANT HSAN7 ALA-1184; CHARACTERIZATION OF VARIANTS HSAN7 PRO-811 AND ALA-1184;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.