UniProtKB/Swiss-Prot Q14353: Variant p.Phe157Leu

Guanidinoacetate N-methyltransferase
Gene: GAMT
Feedback?

Variant information Variant position:

157 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Phenylalanine (F) to Leucine (L) at position 157 (F157L, p.Phe157Leu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from large size and aromatic (F) to medium size and hydrophobic (L) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

No effect on enzymatic activity. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs372260609 [ dbSNP | Ensembl ]

Sequence information Variant position:

157 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

236 The length of the canonical sequence.
Location on the sequence:

YPLSEETWHTHQFNFIKNHA F RLLKPGGVLTYCNLTSWGEL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         YPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGEL

Mouse                         YPLSEEAWHTHQFNFIKNHAFRLLKTGGVLTYCNLTSWGEL

Rat                           YPLSEETWHTHQFNFIKTHAFRLLKPGGILTYCNLTSWGEL

Bovine                        YPLSEETWHTHQFNFIRDHAFRLLKPGGVLTYCNLTSWGEL

Xenopus tropicalis            YPLSEETWHTHQFNFIKGHAYRLLKPGGVLTYCNLTSWGEL

Zebrafish                     YPLSEETWHTHQFNFIKAHAHRMLKPGGVLTYCNLTSWGEL

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	2 – 236	Guanidinoacetate N-methyltransferase
Domain	13 – 236	RMT2
Helix	156 – 159

Literature citations
Carrier frequency of guanidinoacetate methyltransferase deficiency in the general population by functional characterization of missense variants in the GAMT gene.
Desroches C.L.; Patel J.; Wang P.; Minassian B.; Marshall C.R.; Salomons G.S.; Mercimek-Mahmutoglu S.;
Mol. Genet. Genomics 290:2163-2171(2015)
Cited for: VARIANTS VAL-71; MET-78; ILE-95; GLN-105; ARG-146; ASP-156; LEU-157 AND ILE-167; VARIANT CCDS2 PRO-106; CHARACTERIZATION OF VARIANTS VAL-71; MET-78; ILE-95; GLN-105; PRO-106; ARG-146; ASP-156; LEU-157 AND ILE-167; FUNCTION;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.