Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P15538: Variant p.Arg332Gly

Cytochrome P450 11B1, mitochondrial
Gene: CYP11B1
Feedback?
Variant information Variant position: help 332 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Arginine (R) to Glycine (G) at position 332 (R332G, p.Arg332Gly). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to glycine (G) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In AH4; high reduction of steroid 11-beta-monooxygenase activity. Any additional useful information about the variant.


Sequence information Variant position: help 332 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 503 The length of the canonical sequence.
Location on the sequence: help TAGSVDTTVFPLLMTLFELA R NPNVQQALRQESLAAAASIS The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         TAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASIS

Rat                           IAGSVDTTAISLVMTLFELARNPDVQQALRQESLAAEASIV

Pig                           TAGSVDTTAYPLLMTLFELARNPEVQQALRQESLAAAARIS

Bovine                        TAGSVDTTAFPLLMTLFELARNPEVQQAVRQESLVAEARIS

Sheep                         TAGSVDTTAFPLLMTLFELARNPEVQQALRQESLVAEARIS
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 25 – 503 Cytochrome P450 11B1, mitochondrial
Helix 320 – 332



Literature citations
Phenotypic, metabolic, and molecular genetic characterization of six patients with congenital adrenal hyperplasia caused by novel mutations in the CYP11B1 gene.
Nguyen H.H.; Eiden-Plach A.; Hannemann F.; Malunowicz E.M.; Hartmann M.F.; Wudy S.A.; Bernhardt R.;
J. Steroid Biochem. Mol. Biol. 155:126-134(2016)
Cited for: VARIANTS AH4 ARG-318; GLY-332 AND HIS-448; CHARACTERIZATION OF VARIANT GLY-332;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.