Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P35523: Variant p.Gly190Ser

Chloride channel protein 1
Gene: CLCN1
Feedback?
Variant information Variant position: help 190 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Glycine (G) to Serine (S) at position 190 (G190S, p.Gly190Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In MCAR; loss of chloride channel activity. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 190 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 988 The length of the canonical sequence.
Location on the sequence: help VLILFSALFCHLISPQAVGS G IPEMKTILRGVVLKEYLTMK The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         VLILFSALFCHLISPQAVGSGIPEMKTILRGVVLKEYLTMK

                              TLILFSAVFCHLISPQAVGSGIPEMKTILRGVILKEYLTLK

Mouse                         ILILFSALFCQLISPQAVGSGIPEMKTILRGVVLKEYLTLK

Rat                           ILILFSALFCQLISPQAVGSGIPEMKTILRGVVLKEYLTLK
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 988 Chloride channel protein 1
Intramembrane 190 – 195 Helical
Motif 188 – 192 Selectivity filter part_1
Binding site 189 – 189



Literature citations
Myotonia congenita in a large consanguineous Arab family: insight into the clinical spectrum of carriers and double heterozygotes of a novel mutation in the chloride channel CLCN1 gene.
Shalata A.; Furman H.; Adir V.; Adir N.; Hujeirat Y.; Shalev S.A.; Borochowitz Z.U.;
Muscle Nerve 41:464-469(2010)
Cited for: VARIANT MCAR SER-190; Myotonia congenita: novel mutations in CLCN1 gene and functional characterizations in Italian patients.
Ulzi G.; Lecchi M.; Sansone V.; Redaelli E.; Corti E.; Saccomanno D.; Pagliarani S.; Corti S.; Magri F.; Raimondi M.; D'Angelo G.; Modoni A.; Bresolin N.; Meola G.; Wanke E.; Comi G.P.; Lucchiari S.;
J. Neurol. Sci. 318:65-71(2012)
Cited for: VARIANTS MCAR ARG-164; ARG-197; ILE-533; LEU-536; SER-845 AND GLU-947; CHARACTERIZATION OF VARIANTS MCAR ARG-164; SER-190; ARG-197 AND SER-845; FUNCTION; Clinical, molecular, and functional characterization of CLCN1 mutations in three families with recessive myotonia congenita.
Portaro S.; Altamura C.; Licata N.; Camerino G.M.; Imbrici P.; Musumeci O.; Rodolico C.; Conte Camerino D.; Toscano A.; Desaphy J.F.;
NeuroMolecular Med. 17:285-296(2015)
Cited for: VARIANTS MCAR ALA-82; SER-190; VAL-270 AND TRP-453; CHARACTERIZATION OF VARIANTS MCAR ALA-82; SER-190; VAL-270 AND TRP-453; FUNCTION;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.