Home  |  Contact

UniProtKB/Swiss-Prot Q63HN8: Variant p.Gln4367Leu

E3 ubiquitin-protein ligase RNF213
Gene: RNF213
Chromosomal location: 17q25.3
Variant information

Variant position:  4367
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Unclassified
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Glutamine (Q) to Leucine (L) at position 4367 (Q4367L, p.Gln4367Leu).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (Q) to medium size and hydrophobic (L)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  Rare variant detected in a sporadic case of Moyamoya disease in East Asian population.
Any additional useful information about the variant.



Sequence information

Variant position:  4367
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  5207
The length of the canonical sequence.

Location on the sequence:   ECKPLGIKTALKACKTPQSQ  Q SAYFLLTLFREVAILYRSHN
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         ECKPLGIKTALKACKTPQSQQSAYFLLTLFREVAILYRSHN

Mouse                         ECKTLDIGNALMACRSPKPQQTAYLLLALYTEVAALYRSPN

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 5207 E3 ubiquitin-protein ligase RNF213
Alternative sequence 1 – 4650 Missing. In isoform 4.
Alternative sequence 1064 – 5207 Missing. In isoform 3.


Literature citations

Molecular analysis of RNF213 gene for moyamoya disease in the Chinese Han population.
Wu Z.; Jiang H.; Zhang L.; Xu X.; Zhang X.; Kang Z.; Song D.; Zhang J.; Guan M.; Gu Y.;
PLoS ONE 7:E48179-E48179(2012)
Cited for: VARIANTS MYMY2 THR-4399 AND LYS-4810; VARIANTS ARG-4007; LEU-4367; PRO-4586; VAL-4631; ASP-4950; VAL-5021 AND ILE-5136;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.