Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9Y5C1: Variant p.Met259Thr

Angiopoietin-related protein 3
Gene: ANGPTL3
Feedback?
Variant information Variant position: help 259 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Methionine (M) to Threonine (T) at position 259 (M259T, p.Met259Thr). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (M) to medium size and polar (T) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help Common allele in African americans; associated with low plasma triglyceride level; fails to suppress LPL activity in vitro; no effect on protein folding. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 259 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 460 The length of the canonical sequence.
Location on the sequence: help HDGIPAECTTIYNRGEHTSG M YAIRPSNSQVFHVYCDVISG The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         HDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISG

Mouse                         QDDLPADCSAVYNRGEHTSGVYTIKPRNSQGFNVYCDTQSG

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 17 – 460 Angiopoietin-related protein 3
Domain 237 – 455 Fibrinogen C-terminal
Disulfide bond 246 – 274
Beta strand 256 – 262



Literature citations
Structures of Angptl3 and Angptl4, modulators of triglyceride levels and coronary artery disease.
Biterova E.; Esmaeeli M.; Alanen H.I.; Saaranen M.; Ruddock L.W.;
Sci. Rep. 8:6752-6752(2018)
Cited for: X-RAY CRYSTALLOGRAPHY (2.10 ANGSTROMS) OF 242-460; DISULFIDE BONDS; CHARACTERIZATION OF VARIANTS THR-259; GLN-288; PRO-292; SER-344 AND LYS-375; Rare loss-of-function mutations in ANGPTL family members contribute to plasma triglyceride levels in humans.
Romeo S.; Yin W.; Kozlitina J.; Pennacchio L.A.; Boerwinkle E.; Hobbs H.H.; Cohen J.C.;
J. Clin. Invest. 119:70-79(2009)
Cited for: VARIANTS THR-63; GLY-91; PHE-164; SER-173; THR-259; GLN-288; PRO-292; LYS-375 AND CYS-417; CHARACTERIZATION OF VARIANTS THR-63; GLY-91; PHE-164; SER-173; THR-259; ARG-GLN; PRO-292; LYS-375 AND CYS-417;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.