Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O00571: Variant p.Arg362Cys

ATP-dependent RNA helicase DDX3X
Gene: DDX3X
Feedback?
Variant information Variant position: help 362 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Arginine (R) to Cysteine (C) at position 362 (R362C, p.Arg362Cys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to medium size and polar (C) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In MRXSSB. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 362 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 662 The length of the canonical sequence.
Location on the sequence: help KYLVLDEADRMLDMGFEPQI R RIVEQDTMPPKGVRHTMMFS The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         KYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFS

Mouse                         KYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFS

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 2 – 662 ATP-dependent RNA helicase DDX3X
Domain 211 – 403 Helicase ATP-binding
Region 100 – 662 Interaction with GSK3B
Mutagenesis 347 – 347 D -> A. No effect on general translation; when associated with A-200; A-207; A-230 and A-348.
Mutagenesis 348 – 348 E -> A. No effect on general translation; when associated with A-200; A-207; A-230 and A-347.
Mutagenesis 348 – 348 E -> Q. Loss of both ATPase and RNA helicase activities; decreased up-regulation of CDKN1A promoter activity and HNF4A-mediated MTTP transcriptional activation; no effect on the repression of cap- and IRES-dependent translation, WNT/beta catenin signaling, nor on stress granule assembly. Does not promote the translation of HIV-1 RNA.
Mutagenesis 382 – 382 S -> L. Strong decrease in ATPase activity and RNA-unwinding activity. Does not promote the translation of mRNAs containing long structured 5'UTRs, including that of CCNE1. No effect on the translation of HIV-1 RNA.
Helix 358 – 365



Literature citations
Mutations in DDX3X are a common cause of unexplained intellectual disability with gender-specific effects on Wnt signaling.
Snijders Blok L.; Madsen E.; Juusola J.; Gilissen C.; Baralle D.; Reijnders M.R.; Venselaar H.; Helsmoortel C.; Cho M.T.; Hoischen A.; Vissers L.E.; Koemans T.S.; Wissink-Lindhout W.; Eichler E.E.; Romano C.; Van Esch H.; Stumpel C.; Vreeburg M.; Smeets E.; Oberndorff K.; van Bon B.W.; Shaw M.; Gecz J.; Haan E.; Bienek M.; Jensen C.; Loeys B.L.; Van Dijck A.; Innes A.M.; Racher H.; Vermeer S.; Di Donato N.; Rump A.; Tatton-Brown K.; Parker M.J.; Henderson A.; Lynch S.A.; Fryer A.; Ross A.; Vasudevan P.; Kini U.; Newbury-Ecob R.; Chandler K.; Male A.; Dijkstra S.; Schieving J.; Giltay J.; van Gassen K.L.; Schuurs-Hoeijmakers J.; Tan P.L.; Pediaditakis I.; Haas S.A.; Retterer K.; Reed P.; Monaghan K.G.; Haverfield E.; Natowicz M.; Myers A.; Kruer M.C.; Stein Q.; Strauss K.A.; Brigatti K.W.; Keating K.; Burton B.K.; Kim K.H.; Charrow J.; Norman J.; Foster-Barber A.; Kline A.D.; Kimball A.; Zackai E.; Harr M.; Fox J.; McLaughlin J.; Lindstrom K.; Haude K.M.; van Roozendaal K.; Brunner H.; Chung W.K.; Kooy R.F.; Pfundt R.; Kalscheuer V.; Mehta S.G.; Katsanis N.; Kleefstra T.;
Am. J. Hum. Genet. 97:343-352(2015)
Cited for: VARIANTS MRXSSB THR-214; ALA-233 DEL; VAL-233; PRO-235; PHE-300; HIS-326; GLN-351; CYS-362; CYS-376; PRO-392; PRO-417; GLY-475; SER-480; HIS-488; THR-507; ILE-509; THR-514; HIS-534; LEU-560 DEL AND LEU-568; CHARACTERIZATION OF VARIANTS MRXSSB THR-214; HIS-326; CYS-376; THR-507 AND HIS-534; INVOLVEMENT IN MRXSSB;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.