Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q96RP9: Variant p.Arg250Trp

Elongation factor G, mitochondrial
Gene: GFM1
Feedback?
Variant information Variant position: help 250 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Arginine (R) to Tryptophan (W) at position 250 (R250W, p.Arg250Trp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to large size and aromatic (W) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In COXPD1. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 250 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 751 The length of the canonical sequence.
Location on the sequence: help GQIVRYGEIPAELRAAATDH R QELIECVANSDEQLGEMFLE The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         GQIVRY-GEIPAELRAAATDHRQELIECVANSDEQLGEMFLE

Mouse                         GQIVRY-DEIPAGLRAAAADHRQELIECVANSDEQLGELFL

Rat                           GQIVRY-DEIPADLRAAAADHRQELIECVANSDEQLGELFL

Xenopus laevis                GQSVRY-DDIPAEFRAEATDRRQELIESVANSDEILGEMFL

Zebrafish                     GESVRY-EDIPPEMRSEAADRRQELVECVANADETLGEMFL

Caenorhabditis elegans        GLIVRK-DEIPKDLRVEAEDRRQELIEHIANVDETLGEMFL

Drosophila                    GMDIRL-DEIPQDMRVESLERRQELIEHLSNADETLGELFL

Slime mold                    GTAPII-EEIPSNFVEFVKEKKMELVETIANVDDELGEWMI

Baker's yeast                 GEIIEK-GPVPENLKPLMEEKRQLLIETLADVDDEMAEMFL

Fission yeast                 GEKIEISQQVPENLIELAKEKRSALIEKLADLDEEIADIYV

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 37 – 751 Elongation factor G, mitochondrial
Domain 44 – 321 tr-type G
Alternative sequence 230 – 230 G -> GHFLRDFLPLLWNWDRRSGS. In isoform 2.
Helix 243 – 260



Literature citations
Mutation in subdomain G' of mitochondrial elongation factor G1 is associated with combined OXPHOS deficiency in fibroblasts but not in muscle.
Smits P.; Antonicka H.; van Hasselt P.M.; Weraarpachai W.; Haller W.; Schreurs M.; Venselaar H.; Rodenburg R.J.; Smeitink J.A.; van den Heuvel L.P.;
Eur. J. Hum. Genet. 19:275-279(2011)
Cited for: VARIANT COXPD1 TRP-250;
A comprehensive genomic analysis reveals the genetic landscape of mitochondrial respiratory chain complex deficiencies.
Kohda M.; Tokuzawa Y.; Kishita Y.; Nyuzuki H.; Moriyama Y.; Mizuno Y.; Hirata T.; Yatsuka Y.; Yamashita-Sugahara Y.; Nakachi Y.; Kato H.; Okuda A.; Tamaru S.; Borna N.N.; Banshoya K.; Aigaki T.; Sato-Miyata Y.; Ohnuma K.; Suzuki T.; Nagao A.; Maehata H.; Matsuda F.; Higasa K.; Nagasaki M.; Yasuda J.; Yamamoto M.; Fushimi T.; Shimura M.; Kaiho-Ichimoto K.; Harashima H.; Yamazaki T.; Mori M.; Murayama K.; Ohtake A.; Okazaki Y.;
PLoS Genet. 12:E1005679-E1005679(2016)
Cited for: VARIANTS COXPD1 TYR-57 AND TRP-250;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.