UniProtKB/SwissProt variant VAR

Variant information

Variant position:

114

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:

Disease [Disclaimer]

The variants are classified into three categories: Disease, Polymorphism and Unclassified.

Disease: Variants implicated in disease according to literature reports.
Polymorphism: Variants not reported to be implicated in disease.
Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:

From Arginine (R) to Histidine (H) at position 114 (R114H, p.Arg114His).

Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:

Change from large size and basic (R) to medium size and polar (H)

The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:

0

The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page

Involvement in disease:

Epileptic encephalopathy, early infantile, 47 (EIEE47) [MIM:617166]: A form of epileptic encephalopathy, a heterogeneous group of severe childhood onset epilepsies characterized by refractory seizures, neurodevelopmental impairment, and poor prognosis. Development is normal prior to seizure onset, after which cognitive and motor delays become apparent. {ECO:0000269|PubMed:27164707}. Note=The disease is caused by mutations affecting the gene represented in this entry.

The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:

In EIEE47; increased function in positive regulation of SCN8A voltage-dependent sodium channel activity.

Any additional useful information about the variant.

Other resources:

Links to websites of interest for the variant.

Variant rs886039903 [ dbSNP | Ensembl ]

Sequence information

Variant position:

114

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:

243

The length of the canonical sequence.

Location on the sequence:

DGTKDENSDYTLFNLIPVGL R VVAIQGVKASLYVAMNGEGY

The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         DGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGY

Mouse                         DGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGY

Rat                           DGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGY

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 243	Fibroblast growth factor 12
Mutagenesis	114 – 114	R -> A. Gain of function, affects voltage dependence of SCN8A fast inactivation.
Mutagenesis	114 – 114	R -> G. Gain of function, affects voltage dependence of SCN8A fast inactivation.

Literature citations

Gain-of-function FHF1 mutation causes early-onset epileptic encephalopathy with cerebellar atrophy.
Siekierska A.; Isrie M.; Liu Y.; Scheldeman C.; Vanthillo N.; Lagae L.; de Witte P.A.; Van Esch H.; Goldfarb M.; Buyse G.M.;
Neurology 86:2162-2170(2016)
Cited for: FUNCTION; INVOLVEMENT IN EIEE47; VARIANT EIEE47 HIS-114; CHARACTERIZATION OF VARIANT EIEE47 HIS-114; MUTAGENESIS OF ARG-114;

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P61328: Variant p.Arg114His