Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9HB90: Variant p.Ser75Tyr

Ras-related GTP-binding protein C
Gene: RRAGC
Feedback?
Variant information Variant position: help 75 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Serine (S) to Tyrosine (Y) at position 75 (S75Y, p.Ser75Tyr). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from small size and polar (S) to large size and aromatic (Y) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In LNGODS; renders cells partially insensitive to amino acid deprivation and result in activated mTORC1 signaling; results in altered regulation of TOR signaling; increased interaction with TFEB. Any additional useful information about the variant.


Sequence information Variant position: help 75 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 399 The length of the canonical sequence.
Location on the sequence: help GGADSSKPRILLMGLRRSGK S SIQKVVFHKMSPNETLFLES The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         GGADSSKPRILLMGLRRSGKSSIQKVVFHKMSPNETLFLES

Mouse                         GGADSSKPRILLMGLRRSGKSSIQKVVFHKMSPNETLFLES

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 2 – 399 Ras-related GTP-binding protein C
Binding site 71 – 71
Binding site 72 – 72
Binding site 73 – 73
Binding site 74 – 74
Binding site 74 – 74
Binding site 75 – 75
Binding site 76 – 76
Binding site 90 – 90
Binding site 90 – 90
Binding site 94 – 94
Mutagenesis 75 – 75 S -> L. Constitutively active mutant. Increased RPTOR-binding.
Mutagenesis 92 – 92 F -> A. Promotes interaction with GATOR1 in the GAP mode.
Helix 74 – 82



Literature citations
De novo RRAGC mutation activates mTORC1 signaling in syndromic fetal dilated cardiomyopathy.
Long P.A.; Zimmermann M.T.; Kim M.; Evans J.M.; Xu X.; Olson T.M.;
Hum. Genet. 135:909-917(2016)
Cited for: INVOLVEMENT IN LNGODS; VARIANT LNGODS TYR-75; CHARACTERIZATION OF LNGODS VARIANT TYR-75; FUNCTION; TFEB Overexpression, Not mTOR Inhibition, Ameliorates RagCS75Y Cardiomyopathy.
Kim M.; Lu L.; Dvornikov A.V.; Ma X.; Ding Y.; Zhu P.; Olson T.M.; Lin X.; Xu X.;
Int. J. Mol. Sci. 22:0-0(2021)
Cited for: CHARACTERIZATION OF VARIANT LNGODS TYR-75; FUNCTION; INTERACTION WITH TFEB; De novo missense variants in RRAGC lead to a fatal mTORopathy of early childhood.
Reijnders M.R.F.; Seibt A.; Brugger M.; Lamers I.J.C.; Ott T.; Klaas O.; Horvath J.; Rose A.M.S.; Craghill I.M.; Brunet T.; Graf E.; Mayerhanser K.; Hellebrekers D.; Pauck D.; Neuen-Jacob E.; Rodenburg R.J.T.; Wieczorek D.; Klee D.; Mayatepek E.; Driessen G.; Bindermann R.; Averdunk L.; Lohmeier K.; Sinnema M.; Stegmann A.P.A.; Roepman R.; Poulter J.A.; Distelmaier F.;
Genet. Med. 25:100838-100838(2023)
Cited for: VARIANTS LNGODS ASN-90; ARG-115 AND LEU-118; CHARACTERIZATION OF VARIANTS LNGODS TYR-75; ASN-90; ARG-115 AND LEU-118; FUNCTION; INTERACTION WITH TFEB;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.