UniProtKB/Swiss-Prot P35221: Variant p.Ile431Met

Catenin alpha-1
Gene: CTNNA1
Chromosomal location: 5q31
Variant information

Variant position:  431
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Isoleucine (I) to Methionine (M) at position 431 (I431M, p.Ile431Met).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Similar physico-chemical property. Both residues are medium size and hydrophobic.
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Macular dystrophy, patterned, 2 (MDPT2) [MIM:608970]: A form of retinal patterned dystrophy, a heterogeneous group of macular disorders caused by abnormal accumulation of lipofuscin in the retinal pigment epithelium. Lipofuscin distribution can show various shapes that define different types of macular dystrophy, including reticular (fishnet-like) dystrophy, macroreticular (spider-shaped) dystrophy and butterfly-shaped pigment dystrophy. MDPT2 is an autosomal dominant form characterized by bilateral accumulation of pigment in the macular area that resembles the wings of a butterfly. {ECO:0000269|PubMed:26691986}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In MDPT2; no effect on VCL-binding.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  431
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  906
The length of the canonical sequence.

Location on the sequence:   GNEKEVKEYAQVFREHANKL  I EVANLACSISNNEEGVKLVR
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         GNEKEVKEYAQVFREHANKLIEVANLACSISNNEEGVKLVR

Mouse                         GNEKEVKEYAQVFREHANKLIEVANLACSISNNEEGVKLVR

Bovine                        GNEKEVKEYAQVFREHANKLIEVANLACSISNNEEGVKLVR

Rabbit                        GNEKEVKEYAQVFREHANKLIEVANLACSISNNEEGVKLVR

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 2 – 906 Catenin alpha-1
Helix 413 – 438


Literature citations

Mutations in CTNNA1 cause butterfly-shaped pigment dystrophy and perturbed retinal pigment epithelium integrity.
Saksens N.T.; Krebs M.P.; Schoenmaker-Koller F.E.; Hicks W.; Yu M.; Shi L.; Rowe L.; Collin G.B.; Charette J.R.; Letteboer S.J.; Neveling K.; van Moorsel T.W.; Abu-Ltaif S.; De Baere E.; Walraedt S.; Banfi S.; Simonelli F.; Cremers F.P.; Boon C.J.; Roepman R.; Leroy B.P.; Peachey N.S.; Hoyng C.B.; Nishina P.M.; den Hollander A.I.;
Nat. Genet. 48:144-151(2016)
Cited for: INVOLVEMENT IN MDPT2; VARIANTS MDPT2 CYS-54; LYS-307; SER-318 AND MET-431; INTERACTION WITH VCL;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.