Home  |  Contact

UniProtKB/Swiss-Prot Q9UI33: Variant p.Leu1158Pro

Sodium channel protein type 11 subunit alpha
Gene: SCN11A
Variant information

Variant position:  1158
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Leucine (L) to Proline (P) at position 1158 (L1158P, p.Leu1158Pro).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Similar physico-chemical property. Both residues are medium size and hydrophobic.
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Episodic pain syndrome, familial, 3 (FEPS3) [MIM:615552]: An autosomal dominant neurologic disorder characterized by paroxysmal pain mainly affecting the distal lower extremities and occasionally the upper body, especially the joints of fingers and arms. The pain is exacerbated with fatigue. {ECO:0000269|PubMed:24207120, ECO:0000269|PubMed:24776970, ECO:0000269|PubMed:25791876, ECO:0000269|PubMed:27224030}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In FEPS3; slows deactivation; depolarizes resting membrane potential; enhances spontaneous firing; decreases rates of current decay; does not change fast-inactivation; does not change slow-inactivation.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  1158
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1791
The length of the canonical sequence.

Location on the sequence:   INLMELKSFRTLRALRPLRA  L SQFEGMKVVVNALIGAIPAI
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         INLMELKSFRTLRALRPLRALSQFEGMKVVVNALIGAIPAI

Mouse                         TNLPNLKSFRNLRALRPLRALSQFEGMKVVVNALMSAIPAI

Rat                           MNLPSLKSFRTLRALRPLRALSQFEGMKVVVYALISAIPAI

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 1791 Sodium channel protein type 11 subunit alpha
Topological domain 1139 – 1139 Extracellular
Transmembrane 1140 – 1161 Helical; Voltage-sensor; Name=S4 of repeat III
Repeat 1044 – 1339 III


Literature citations

Gain-of-function mutations in sodium channel Na(v)1.9 in painful neuropathy.
Huang J.; Han C.; Estacion M.; Vasylyev D.; Hoeijmakers J.G.; Gerrits M.M.; Tyrrell L.; Lauria G.; Faber C.G.; Dib-Hajj S.D.; Merkies I.S.; Waxman S.G.;
Brain 137:1627-1642(2014)
Cited for: VARIANTS FEPS3 THR-381 AND PRO-1158; VARIANTS ASN-419; THR-582; ASP-681; PRO-842 AND LEU-1689; CHARACTERIZATION OF VARIANTS FEPS3 THR-381 AND PRO-1158;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.