Home  |  Contact

UniProtKB/Swiss-Prot Q16854: Variant p.Asn46Ser

Deoxyguanosine kinase, mitochondrial
Gene: DGUOK
Chromosomal location: 2p13
Variant information

Variant position:  46
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Asparagine (N) to Serine (S) at position 46 (N46S, p.Asn46Ser).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (N) to small size and polar (S)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Portal hypertension, non-cirrhotic (NCPH) [MIM:617068]: An autosomal recessive disorder characterized by portal hypertension associated with hepatosplenomegaly, in absence of cirrhosis, extrahepatic diseases, and splanchnic venous thrombosis. Portal hypertension is defined by a portal venous system pressure that is at least 5 mm Hg higher than the pressure in the inferior vena cava. High pressure in the portal venous system leads to shunting of blood through vessels that are poorly suited to carrying large blood volumes, resulting in collateral circulation and splenomegaly. NCPH patients show normal liver function. {ECO:0000269|PubMed:17073823, ECO:0000269|PubMed:26874653}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In NCPH; impairs adenosine triphosphate binding; reduction of activity.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  46
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  277
The length of the canonical sequence.

Location on the sequence:   VSSSRGLHAGRGPRRLSIEG  N IAVGKSTFVKLLTKTYPEWH
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         VSSSRGLHAGRGPRRLSIEGNIAVGKSTFVKLLTKTYPEWH

Mouse                         APHARAMHDGGGPRRLCIEGNIAVGKSTFVKLLMKTHPEWQ

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 40 – 277 Deoxyguanosine kinase, mitochondrial
Nucleotide binding 45 – 53 ATP
Alternative sequence 47 – 47 I -> IGNILKQIRGRAPIQET. In isoform 5.


Literature citations

Kinetic properties of mutant deoxyguanosine kinase in a case of reversible hepatic mtDNA depletion.
Mousson de Camaret B.; Taanman J.W.; Padet S.; Chassagne M.; Mayencon M.; Clerc-Renaud P.; Mandon G.; Zabot M.T.; Lachaux A.; Bozon D.;
Biochem. J. 402:377-385(2007)
Cited for: FUNCTION; CHARACTERIZATION OF VARIANT NCPH SER-46; CHARACTERIZATION OF VARIANT ARG-266;

Recurrent recessive mutation in deoxyguanosine kinase causes idiopathic noncirrhotic portal hypertension.
Vilarinho S.; Sari S.; Yilmaz G.; Stiegler A.L.; Boggon T.J.; Jain D.; Akyol G.; Dalgic B.; Guenel M.; Lifton R.P.;
Hepatology 63:1977-1986(2016)
Cited for: INVOLVEMENT IN NCPH; VARIANT NCPH SER-46;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.