Home  |  Contact
Due to work on this service, it may not be fully operational on Wednesday March 20 between 1.30 pm and 2.30 pm CEST. Apologies for the inconvenience.

UniProtKB/Swiss-Prot Q9P2R6: Variant p.His1431Gln

Arginine-glutamic acid dipeptide repeats protein
Gene: RERE
Chromosomal location: 1p36.1-p36.2
Variant information

Variant position:  1431
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Unclassified
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Histidine (H) to Glutamine (Q) at position 1431 (H1431Q, p.His1431Gln).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Similar physico-chemical property. Both residues are medium size and polar.
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Neurodevelopmental disorder with or without anomalies of the brain, eye, or heart (NEDBEH) [MIM:616975]: An autosomal dominant syndrome characterized by developmental delay, intellectual disability, brain anomalies, and neurological abnormalities including seizures, hypotonia, and behavioral problems such as autism spectrum disorders. Brain anomalies include abnormalities and/or thinning of the corpus callosum, diminished white matter volume, abnormal cerebellar vermis, and ventriculomegaly. Congenital defects of the eye, heart and genitourinary system are present in half of the patients. {ECO:0000269|PubMed:27087320}. Note=The disease may be caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In NEDBEH; unknown pathological significance.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  1431
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1566
The length of the canonical sequence.

Location on the sequence:   SDPLARLQMFNVTPHHHQHS  H IHSHLHLHQQDPLHQGSAGP
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         SDPLARLQMFNVTPHHHQHSHIHSHLHLHQQDPLHQGSAGP

Mouse                         SDPLARLQMFNVTPHHHQHSHIHSHLHLHQQDPLHQGSAGP

Rat                           SDPLARLQMFNVTPHHHQHSHIHSHLHLHQQDPLHQGSAGP

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 1566 Arginine-glutamic acid dipeptide repeats protein
Compositional bias 1425 – 1445 His-rich


Literature citations

De novo mutations of RERE cause a genetic syndrome with features that overlap those associated with proximal 1p36 deletions.
Fregeau B.; Kim B.J.; Hernandez-Garcia A.; Jordan V.K.; Cho M.T.; Schnur R.E.; Monaghan K.G.; Juusola J.; Rosenfeld J.A.; Bhoj E.; Zackai E.H.; Sacharow S.; Baranano K.; Bosch D.G.; de Vries B.B.; Lindstrom K.; Schroeder A.; James P.; Kulch P.; Lalani S.R.; van Haelst M.M.; van Gassen K.L.; van Binsbergen E.; Barkovich A.J.; Scott D.A.; Sherr E.H.;
Am. J. Hum. Genet. 98:963-970(2016)
Cited for: INVOLVEMENT IN NEDBEH; VARIANTS NEDBEH ILE-471; ARG-1156; ARG-1262 AND GLN-1431; CHARACTERIZATION OF VARIANT NEDBEH ARG-1156;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.