Home  |  Contact

UniProtKB/Swiss-Prot Q9NQX0: Variant p.Arg549Gln

Putative histone-lysine N-methyltransferase PRDM6
Gene: PRDM6
Chromosomal location: 5q23.2
Variant information

Variant position:  549
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Arginine (R) to Glutamine (Q) at position 549 (R549Q, p.Arg549Gln).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (R) to medium size and polar (Q)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Patent ductus arteriosus 3 (PDA3) [MIM:617039]: A congenital heart defect characterized by the persistent opening of fetal ductus arteriosus that fails to close after birth. Fetal ductus arteriosus connects the pulmonary artery to the descending aorta, allowing unoxygenated blood to bypass the lung and flow to the placenta. Normally, the ductus occludes shortly after birth. {ECO:0000269|PubMed:27181681}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In PDA3.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  549
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  595
The length of the canonical sequence.

Location on the sequence:   FKCGYCGRAFAGATTLNNHI  R THTGEKPFKCERCERSFTQA
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         FKCGYCGRAFAGATTLNNHIRTHTGEKPFKCERCERSFTQA

Mouse                         FKCGYCGRAFAGATTLNNHIRTHTGEKPFKCERCERSFTQA

Bovine                        FKCGYCGRAFAGATTLNNHIRTHTGEKPFKCERCERSFTQA

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 595 Putative histone-lysine N-methyltransferase PRDM6
Zinc finger 529 – 551 C2H2-type 3
Alternative sequence 314 – 595 Missing. In isoform 2.


Literature citations

Mutations in the histone modifier PRDM6 are associated with isolated nonsyndromic patent ductus arteriosus.
Li N.; Subrahmanyan L.; Smith E.; Yu X.; Zaidi S.; Choi M.; Mane S.; Nelson-Williams C.; Bahjati M.; Kazemi M.; Hashemi M.; Fathzadeh M.; Narayanan A.; Tian L.; Montazeri F.; Mani M.; Begleiter M.L.; Coon B.G.; Lynch H.T.; Olson E.N.; Zhao H.; Ruland J.; Lifton R.P.; Mani A.;
Am. J. Hum. Genet. 98:1082-1091(2016)
Cited for: INVOLVEMENT IN PDA3; VARIANTS PDA3 SER-263; ARG-462 AND GLN-549;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.