Home  |  Contact

UniProtKB/Swiss-Prot Q99835: Variant p.Leu412Phe

Smoothened homolog
Gene: SMO
Variant information

Variant position:  412
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Leucine (L) to Phenylalanine (F) at position 412 (L412F, p.Leu412Phe).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and hydrophobic (L) to large size and aromatic (F)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Curry-Jones syndrome (CRJS) [MIM:601707]: A multisystem disorder characterized by patchy skin lesions, polysyndactyly, diverse cerebral malformations, unicoronal craniosynostosis, iris colobomas, microphthalmia, and intestinal malrotation with myofibromas or hamartomas. {ECO:0000269|PubMed:24859340, ECO:0000269|PubMed:27236920}. Note=The disease is caused by mutations affecting the gene represented in this entry. 8 individuals have been identified with the disease-causing mutation Phe-412 and all were mosaic. The mutation could not be reliably detected in blood, greatest success rates were obtained with affected tissues obtained by invasive procedures. It is thought that the mutation has arisen postzygotically early during embryonic development (PubMed:27236920). This mutation has also been identified in ameloblastoma, medulloblastoma, meningioma, and basal cell carcinoma, and has been reported as the oncogenic driver in some of these tumors (PubMed:24859340). {ECO:0000269|PubMed:24859340, ECO:0000269|PubMed:27236920}.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In CRJS; constitutive activation of the smoothened signaling pathway.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  412
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  787
The length of the canonical sequence.

Location on the sequence:   VGYKNYRYRAGFVLAPIGLV  L IVGGYFLIRGVMTLFSIKSN
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         VGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSN

Mouse                         VGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSN

Rat                           VGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSN

Drosophila                    VGYINHSMRAGLLLGPLCGVILIGGYFITRGMVMLFGLKHF

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 28 – 787 Smoothened homolog
Transmembrane 403 – 423 Helical; Name=5
Helix 405 – 432


Literature citations

A recurrent mosaic mutation in SMO, encoding the hedgehog signal transducer smoothened, is the major cause of Curry-Jones syndrome.
Twigg S.R.; Hufnagel R.B.; Miller K.A.; Zhou Y.; McGowan S.J.; Taylor J.; Craft J.; Taylor J.C.; Santoro S.L.; Huang T.; Hopkin R.J.; Brady A.F.; Clayton-Smith J.; Clericuzio C.L.; Grange D.K.; Groesser L.; Hafner C.; Horn D.; Temple I.K.; Dobyns W.B.; Curry C.J.; Jones M.C.; Wilkie A.O.;
Am. J. Hum. Genet. 98:1256-1265(2016)
Cited for: INVOLVEMENT IN CRJS; VARIANT CRJS PHE-412;

Identification of recurrent SMO and BRAF mutations in ameloblastomas.
Sweeney R.T.; McClary A.C.; Myers B.R.; Biscocho J.; Neahring L.; Kwei K.A.; Qu K.; Gong X.; Ng T.; Jones C.D.; Varma S.; Odegaard J.I.; Sugiyama T.; Koyota S.; Rubin B.P.; Troxell M.L.; Pelham R.J.; Zehnder J.L.; Beachy P.A.; Pollack J.R.; West R.B.;
Nat. Genet. 46:722-725(2014)
Cited for: VARIANT CRJS PHE-412; VARIANT LEU-535; CHARACTERIZATION OF VARIANT CRJS PHE-412; CHARACTERIZATION OF VARIANT LEU-535;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.