Home  |  Contact

UniProtKB/Swiss-Prot Q9GZZ9: Variant p.Val260Met

Ubiquitin-like modifier-activating enzyme 5
Gene: UBA5
Variant information

Variant position:  260
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Valine (V) to Methionine (M) at position 260 (V260M, p.Val260Met).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Similar physico-chemical property. Both residues are medium size and hydrophobic.
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Epileptic encephalopathy, early infantile, 44 (EIEE44) [MIM:617132]: A form of epileptic encephalopathy, a heterogeneous group of severe childhood onset epilepsies characterized by refractory seizures, neurodevelopmental impairment, and poor prognosis. Development is normal prior to seizure onset, after which cognitive and motor delays become apparent. EIEE44 transmission pattern is consistent with autosomal recessive inheritance. {ECO:0000269|PubMed:27545674, ECO:0000269|PubMed:27545681}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In EIEE44; reduces UFM1 activating enzyme activity.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  260
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  404
The length of the canonical sequence.

Location on the sequence:   DEKTLKREGVCAASLPTTMG  V VAGILVQNVLKFLLNFGTVS
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         DEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLNFGTVS

Mouse                         DEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLKFGTVS

Rat                           DEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLKFGTVS

Bovine                        DEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLNFGTVS

Chicken                       DEKTLKREGVCAASLPTTMGVVAGILVQNVLKYLLNFGTVS

Xenopus laevis                DEKTLKREGVCAASLPTTMGVVAGILVQNVLKYLLNFGTVS

Xenopus tropicalis            DEKTLKREGVCAASLPTTMGVVAGMLVQNVLKYLLNFGTVS

Zebrafish                     DEKTLKRDGVCAASLPTTMGVVAGLLVQNVLKYLLGFGTVS

Caenorhabditis elegans        DERTLKRDGVCAASLPTTMAVVAGFLVMNTLKYLLNFGEVS

Drosophila                    DEKTLKREGVCAASLPTTMGITAGFLVQNALKYLLNFGEVS

Slime mold                    DERTLKREGVCAASLPTTMGIVAGMLVQNTLKYLLKFGEVS

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 404 Ubiquitin-like modifier-activating enzyme 5
Active site 250 – 250 Glycyl thioester intermediate
Mutagenesis 250 – 250 C -> S. Forms a stable intermediate complex.
Helix 247 – 274


Literature citations

Biallelic variants in UBA5 reveal that disruption of the UFM1 cascade can result in early-onset encephalopathy.
Colin E.; Daniel J.; Ziegler A.; Wakim J.; Scrivo A.; Haack T.B.; Khiati S.; Denomme A.S.; Amati-Bonneau P.; Charif M.; Procaccio V.; Reynier P.; Aleck K.A.; Botto L.D.; Herper C.L.; Kaiser C.S.; Nabbout R.; N'Guyen S.; Mora-Lorca J.A.; Assmann B.; Christ S.; Meitinger T.; Strom T.M.; Prokisch H.; Miranda-Vizuete A.; Hoffmann G.F.; Lenaers G.; Bomont P.; Liebau E.; Bonneau D.;
Am. J. Hum. Genet. 99:695-703(2016)
Cited for: INVOLVEMENT IN EIEE44; VARIANTS EIEE44 VAL-57; GLU-168; MET-260; THR-371 AND TYR-389; CHARACTERIZATION OF VARIANTS EIEE44 VAL-57; GLU-168; MET-260; THR-371 AND TYR-389; FUNCTION;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.