Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9NQ40: Variant p.Asn21Ser

Solute carrier family 52, riboflavin transporter, member 3
Gene: SLC52A3
Feedback?
Variant information Variant position: help 21 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Asparagine (N) to Serine (S) at position 21 (N21S, p.Asn21Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (N) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In BVVLS1; loss of localization to cell membrane; loss of riboflavin transport. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 21 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 469 The length of the canonical sequence.
Location on the sequence: help MAFLMHLLVCVFGMGSWVTI N GLWVELPLLVMELPEGWYLP The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         MAFLMHLLVCVFGMGSWVTINGLWVELPLLVMELPEGWYLP

Mouse                         MAFLTHLLVCVFGMGSWVAINGLWVELPLLVTELPEAWYLP

Rat                           MAFLTHLLVCVFGMGSWVAINGLWVELPLLVTKLPEGWYLP

Bovine                        MAFLIHLLVCTFGMGSWVAINGLWVELPLLVTELPEGWYLP

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 469 Solute carrier family 52, riboflavin transporter, member 3
Transmembrane 3 – 23 Helical
Helix 18 – 30



Literature citations
Four novel C20orf54 mutations identified in Brown-Vialetto-Van Laere syndrome patients.
Dezfouli M.A.; Yadegari S.; Nafissi S.; Elahi E.;
J. Hum. Genet. 57:613-617(2012)
Cited for: VARIANTS BVVLS1 SER-21; HIS-220; VAL-312 AND ASP-375;
SLC52A2 [p.P141T] and SLC52A3 [p.N21S] causing Brown-Vialetto-Van Laere syndrome in an Indian patient: First genetically proven case with mutations in two riboflavin transporters.
Udhayabanu T.; Subramanian V.S.; Teafatiller T.; Gowda V.K.; Raghavan V.S.; Varalakshmi P.; Said H.M.; Ashokkumar B.;
Clin. Chim. Acta 462:210-214(2016)
Cited for: VARIANT BVVLS1 SER-21; CHARACTERIZATION OF VARIANT BVVLS1 SER-21; FUNCTION; TRANSPORTER ACTIVITY; SUBCELLULAR LOCATION;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.